Recombinant Human Protein FAM180B (FAM180B)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on shipping method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please specify it in your order; we will prioritize its development.
Synonyms
FAM180B; Protein FAM180B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
FAM180B
Target Protein Sequence
MTRITELWSSPQWKVGAEVCGRQMREQRTAEQSETQRTWLSMAATLQFLVCLVVAICLLS GVTTTQPHAGQPMDSTSVGGGLQEPEAPEVMFELLWAGLELDVMGQLHIQDEELASTHPG RRLRLLLQHHVPSDLEGTEQWLQQLQDLRKGPPLSTWDFEHLLLTGLSCVYRLHAASEAE ERGRWAQVFALLAQETLWDLCKGFCPQDRPPSLGSWASILDPFP
Uniprot No.

Target Background

Database Links

HGNC: 34451

KEGG: hsa:399888

UniGene: Hs.502529

Protein Families
FAM180 family
Subcellular Location
Secreted.

Q&A

What is FAM180B and what are its key molecular characteristics?

FAM180B (Family with sequence similarity 180, member B) is a human protein encoded by the FAM180B gene (Gene ID: 399888). The protein has a molecular mass of approximately 20.1 kDa when expressed recombinantly with tags such as MYC/DDK . Its reference sequence information includes mRNA RefSeq NM_001164379.1 and protein RefSeq NP_001157851.1, with UniProt identification Q6P0A1 .

When designing experiments involving FAM180B, researchers should note that recombinant versions typically include buffer components such as 25 mM Tris.HCl (pH 7.3), 100 mM glycine, and 10% glycerol to maintain protein stability . These buffer characteristics should be considered when integrating the protein into experimental protocols, particularly when combining with other reagents that might be affected by pH or salt concentration.

How is recombinant FAM180B typically expressed and what expression systems yield optimal results?

Recombinant human FAM180B is most commonly expressed in human embryonic kidney cell lines, particularly HEK293 or HEK293T cells . These mammalian expression systems are preferred for human proteins when post-translational modifications and proper folding are critical to maintain native functionality.

The methodological approach for optimal expression typically involves:

  • Cloning the FAM180B coding sequence into an appropriate expression vector containing desired tags (commonly MYC/DDK tags at the C-terminus)

  • Transfecting the expression construct into HEK293/HEK293T cells

  • Allowing protein expression under controlled conditions

  • Harvesting and purifying the protein through affinity chromatography, leveraging the incorporated tags

  • Verifying protein identity and purity through methods such as Western blotting and BCA protein assay

Researchers should be aware that expression conditions, including temperature, transfection reagents, and harvest timing can significantly impact yield and functionality of the recombinant protein.

What considerations are essential for designing experiments involving FAM180B recombinant protein?

When designing experiments with FAM180B recombinant protein, several critical factors must be addressed:

  • Protein stability: Store the protein according to manufacturer recommendations, typically at -80°C with minimal freeze-thaw cycles. Working aliquots should be prepared to prevent repeated freezing and thawing of stock solutions .

  • Buffer compatibility: The standard buffer formulation (25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol) must be compatible with downstream applications . Buffer exchange may be necessary for certain experimental techniques.

  • Tag interference: The presence of MYC/DDK tags may interfere with protein function or interaction studies. Control experiments with untagged protein or alternative tag positions should be considered when assessing protein functionality .

  • Experimental controls: Include appropriate positive and negative controls as reference points. For interaction studies, this might include known binding partners or structurally similar proteins without expected interaction.

  • Replication design: As emphasized in good experimental design practices, proper replication and randomization are essential to minimize bias and increase statistical power . Biological replicates (independent protein preparations) and technical replicates should both be incorporated.

For optimal experimental design, researchers should implement blocking strategies when applicable, which group similar experimental units together to reduce variability and improve detection power, as noted in general experimental design principles .

What methods are most effective for validating the identity and purity of recombinant FAM180B protein?

Validating recombinant FAM180B requires a multi-method approach:

  • Western blotting: Using antibodies specific to FAM180B or to the attached tags (MYC/DDK) to confirm the protein's molecular weight (approximately 20.1 kDa for the tagged version) .

  • Mass spectrometry: For definitive identification and sequence coverage confirmation, MS/MS analysis provides peptide mapping that can be matched against the expected sequence.

  • Protein concentration and purity assessment: Microplate BCA method is commonly used to determine concentration (typically >50 μg/mL) . SDS-PAGE with Coomassie or silver staining can be used to visually assess purity, with densitometry for quantitative analysis.

  • Functional validation: When possible, activity assays specific to the protein's known function should be performed to confirm biological activity of the recombinant protein.

  • SEC-MALS (Size Exclusion Chromatography with Multi-Angle Light Scattering): This technique can provide information about protein homogeneity, oligomeric state, and potential aggregation.

When interpreting validation results, researchers should be aware that recombinant FAM180B preparations typically achieve purities of >90% for research applications, though specifications may vary between suppliers and applications.

How is FAM180B potentially involved in neurodegenerative disease pathways, and what experimental approaches would best investigate these connections?

Recent research has identified FAM180B as potentially relevant in the context of neurodegenerative diseases, particularly in studies examining shared genetic architecture between Alzheimer's disease (AD) and glaucoma . While the specific role of FAM180B remains under investigation, its potential association with other genes implicated in these conditions warrants further study.

To investigate FAM180B's role in neurodegenerative pathways, researchers might consider:

  • Gene association studies: Utilizing conditional FDR (False Discovery Rate) and conjunctional FDR analyses to identify pleiotropic relationships between FAM180B and genes known to be involved in neurodegeneration .

  • Pathway analysis: Examining whether FAM180B participates in key pathways already implicated in neurodegeneration, such as positive regulation of cell death (GO:0010942) or apoptotic signaling pathways (GO:0097190) .

  • Protein-protein interaction studies: Using co-immunoprecipitation with recombinant FAM180B to identify binding partners among proteins known to be involved in neurodegenerative processes, particularly those related to amyloid-beta or tau pathology.

  • Cell-based models: Utilizing cellular models of neurodegeneration (such as primary neurons or neuronal cell lines) with FAM180B knockdown/overexpression to observe effects on cellular survival, apoptosis markers, and response to neurodegenerative stressors.

  • Animal models: Creating or utilizing existing animal models of neurodegeneration with modified FAM180B expression to examine in vivo effects on disease progression and phenotypes.

These approaches should be designed with careful attention to experimental controls and replication to ensure reliable, unbiased results that can advance understanding of FAM180B's potential role in neurodegenerative processes.

What are the challenges in differentiating the functions of native versus recombinant FAM180B in research applications?

Differentiating between native and recombinant FAM180B functions presents several methodological challenges:

  • Post-translational modifications (PTMs): While HEK293/HEK293T expression systems can perform many human PTMs, they may not perfectly recapitulate the specific modifications present on native FAM180B in all tissue contexts . Researchers should consider:

    • Phosphoproteomic analysis to compare phosphorylation patterns

    • Glycoproteomic analysis to identify differences in glycosylation

    • Using tissue-specific expression systems when particular modifications are critical

  • Structural differences: The addition of tags (MYC/DDK) may alter protein folding or expose/obscure functional domains . Methodological approaches to address this include:

    • Parallel experiments with differently tagged versions

    • Comparisons with tag-cleaved recombinant protein

    • Structural analysis via circular dichroism or limited proteolysis

  • Concentration effects: Recombinant proteins are often used at higher concentrations than physiologically relevant levels. Researchers should:

    • Perform dose-response experiments

    • Compare concentration levels to those documented in relevant tissues

    • Include appropriate controls to account for concentration-dependent effects

  • Functional validation: To ensure the recombinant protein maintains native functions:

    • Develop functional assays based on known or predicted activities

    • Compare activity with protein isolated from relevant human tissues when possible

    • Use knockdown/knockout models with complementation by recombinant protein to test functional equivalence

These considerations are essential for accurate interpretation of experimental results and for ensuring that findings are physiologically relevant.

What experimental approaches can best determine the subcellular localization of FAM180B and its implications for protein function?

To determine FAM180B's subcellular localization, researchers should employ multiple complementary techniques:

  • Immunofluorescence microscopy: Using antibodies against FAM180B or its tags (for recombinant versions) in combination with organelle markers to visualize localization patterns. This approach should include:

    • Z-stack imaging to capture three-dimensional distribution

    • Co-localization analysis with markers for various cellular compartments

    • Live-cell imaging when possible to observe dynamic localization

  • Subcellular fractionation: Physically separating cellular components and using Western blotting to detect FAM180B in different fractions. This biochemical approach provides quantitative data to supplement microscopy observations.

  • Proximity labeling techniques: Methods such as BioID or APEX2 can identify proteins in close proximity to FAM180B, providing insights into its microenvironment and potential interacting partners.

  • Sequence-based prediction tools: In silico analysis of the protein sequence to identify targeting signals (nuclear localization signals, mitochondrial targeting sequences, etc.) which can guide experimental design.

  • Localization mutants: Creating mutants with altered predicted localization signals to test the functional importance of specific cellular locations.

Based on broader analyses of proteins with similar characteristics, researchers should pay particular attention to potential cytosolic, nuclear, and mitochondrial localization, as these compartments have been implicated for proteins with similar molecular profiles .

Understanding FAM180B's subcellular localization will provide critical insights into its potential functions and involvement in specific cellular pathways and processes.

How can researchers effectively analyze potential protein-protein interactions involving FAM180B?

Investigating protein-protein interactions (PPIs) involving FAM180B requires a multi-faceted approach:

  • Co-immunoprecipitation (Co-IP): Using antibodies against FAM180B or its tags to pull down protein complexes, followed by mass spectrometry or Western blotting to identify interacting partners. Methodological considerations include:

    • Forward and reverse Co-IP to confirm interactions

    • Appropriate controls including IgG controls and known non-interactors

    • Varying buffer conditions to identify stable versus transient interactions

  • Yeast two-hybrid (Y2H) screening: This allows systematic screening for potential interactors but should be followed by validation using other methods due to potential false positives.

  • Proximity-based approaches:

    • FRET/BRET to detect interactions in living cells

    • Proximity ligation assay (PLA) for detecting endogenous protein interactions

    • BioID or APEX2 proximity labeling to identify proteins in the same microenvironment

  • Surface plasmon resonance (SPR) or biolayer interferometry (BLI): These methods provide quantitative measurements of binding kinetics between purified proteins, offering insights into the strength and dynamics of interactions.

  • Structural studies: For confirmed interactions, X-ray crystallography, NMR, or cryo-EM of complexes can provide detailed information about interaction interfaces.

When analyzing results, researchers should pay special attention to potential interactions with proteins involved in apoptotic pathways or positive regulation of cell death, as initial studies suggest FAM180B might function in these contexts . Additionally, consider potential interactions with mitochondrial proteins, as some related proteins have been identified in this organelle.

What methodological approaches best examine the potential role of FAM180B in neurodegenerative disease mechanisms?

To thoroughly investigate FAM180B's potential role in neurodegenerative diseases, researchers should implement a multi-level experimental strategy:

  • Genetic association analysis: Building on existing knowledge, researchers should:

    • Perform conditional and conjunctional FDR analyses to identify pleiotropic relationships between FAM180B and known neurodegenerative disease genes

    • Conduct SNP analysis focusing on FAM180B loci in patient populations

    • Examine potential gene-gene interactions between FAM180B and established risk genes

  • Expression studies in disease tissues:

    • Analyze FAM180B protein and mRNA levels in post-mortem brain tissues from neurodegenerative disease patients versus controls

    • Examine expression in specific cell types using single-cell RNA sequencing data

    • Investigate potential alterations in splicing or post-translational modifications in disease states

  • Cellular models of neurodegeneration:

    • Manipulate FAM180B expression (overexpression/knockdown) in neuronal models exposed to amyloid-beta, tau aggregates, or other neurodegenerative stressors

    • Measure impact on cell survival, apoptotic markers, and mitochondrial function

    • Assess changes in calcium homeostasis, oxidative stress, and inflammatory response

  • Animal models:

    • Generate transgenic models with altered FAM180B expression

    • Cross with existing neurodegenerative disease models to observe effects on disease progression

    • Conduct behavioral, histological, and biochemical analyses to characterize phenotypes

  • Mechanistic studies:

    • Investigate whether FAM180B interacts with key proteins implicated in neurodegeneration

    • Determine if FAM180B affects protein aggregation or clearance pathways

    • Explore potential involvement in mitochondrial function, given the enrichment of related proteins in mitochondrial pathways

These approaches should be conducted with appropriate controls and replication, recognizing that disease mechanisms are complex and likely involve multiple genetic and environmental factors.

How should researchers interpret conflicting data regarding FAM180B expression patterns in different tissues and disease states?

When facing conflicting data about FAM180B expression across tissues or disease states, researchers should implement the following methodological approach:

  • Technical validation across platforms:

    • Compare results across multiple detection methods (qPCR, Western blot, immunohistochemistry, RNA-seq)

    • Evaluate antibody specificity using knockout/knockdown controls

    • Consider the detection limits and dynamic range of each method

  • Biological variables assessment:

    • Stratify data by age, sex, disease stage, and comorbidities

    • Account for medication effects in patient samples

    • Consider circadian or other temporal variations in expression

  • Cell type heterogeneity analysis:

    • Use single-cell approaches to resolve cell type-specific expression patterns

    • Apply digital spatial profiling or similar techniques to understand expression in tissue context

    • Consider the proportional representation of different cell types in bulk tissue samples

  • Methodological reconciliation framework:

    • Develop a standardized reporting template that includes all relevant experimental variables

    • Create a decision tree for evaluating the strength of evidence from conflicting studies

    • Apply meta-analytical approaches when sufficient studies are available

  • Experimental design to resolve conflicts:

    • Design studies specifically to address discrepancies, with sufficient power and controls

    • Include positive and negative control genes with well-established expression patterns

    • Implement blinded analysis protocols to minimize bias

When interpreting results, researchers should consider that expression patterns may genuinely differ based on biological context, and apparent conflicts may reflect actual biological variability rather than technical issues. The evidence suggests that some genes like FAM180B may have context-dependent expression patterns, with potential relevance to specific disease mechanisms .

What are the most common challenges in working with recombinant FAM180B and how can they be addressed?

Researchers working with recombinant FAM180B may encounter several technical challenges:

  • Protein solubility issues:

    • Challenge: Precipitation or aggregation during storage or experimental procedures

    • Solutions:

      • Optimize buffer conditions (consider testing various pH ranges, salt concentrations, and additives)

      • Add stabilizing agents such as glycerol (typically 10%) or low concentrations of non-ionic detergents

      • Aliquot and store at -80°C to minimize freeze-thaw cycles

      • Consider tag position alternatives if aggregation persists

  • Tag interference with function:

    • Challenge: MYC/DDK tags may affect protein folding or functional domains

    • Solutions:

      • Design constructs with cleavable tags

      • Test multiple tag positions (N-terminal vs. C-terminal)

      • Compare results with untagged versions when possible

      • Use smaller tags for sensitive applications

  • Expression yield variability:

    • Challenge: Inconsistent protein yields between batches

    • Solutions:

      • Standardize transfection conditions (cell density, reagent ratios, incubation times)

      • Monitor cell health and passage number

      • Optimize codon usage for expression system

      • Consider stable cell line development for consistent expression

  • Protein activity assessment:

    • Challenge: Lack of established functional assays for FAM180B

    • Solutions:

      • Develop assays based on predicted functions or structural features

      • Use binding partner interactions as proxy measures for functionality

      • Implement thermal shift assays to assess proper folding

  • Contamination with host cell proteins:

    • Challenge: Co-purification of host cell proteins

    • Solutions:

      • Implement multiple purification steps (e.g., ion exchange after affinity chromatography)

      • Optimize washing conditions during affinity purification

      • Validate purity using mass spectrometry and SDS-PAGE

These technical considerations align with good experimental design principles, where preventing experimental problems through thoughtful planning can save considerable time and resources .

How can researchers optimize storage and handling conditions to maintain FAM180B protein stability and activity?

Maintaining FAM180B stability and activity requires careful attention to storage and handling conditions:

  • Temperature management:

    • Store stock solutions at -80°C for long-term stability

    • Avoid repeated freeze-thaw cycles by preparing single-use aliquots

    • When working with the protein, keep on ice or at 4°C to minimize degradation

    • Monitor the effects of temperature on activity if functional assays are available

  • Buffer optimization:

    • Standard buffer (25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol) provides initial stability

    • For applications requiring buffer exchange, perform gradual dialysis at 4°C

    • Consider adding protease inhibitors for sensitive applications

    • Test stability in application-specific buffers before conducting critical experiments

  • Concentration effects:

    • Protein may behave differently at various concentrations

    • At high concentrations, monitor for aggregation using dynamic light scattering

    • At low concentrations, consider adding carriers like BSA to prevent loss through surface adsorption

    • Document concentration-dependent behavior in functional assays

  • Handling practices:

    • Use low-binding tubes and pipette tips to minimize protein loss

    • Avoid introducing bubbles or foam during pipetting

    • Centrifuge briefly after thawing to collect any condensation

    • Use clean, dedicated equipment to prevent contamination

  • Stability monitoring:

    • Implement regular quality control testing for long-term storage

    • Consider thermal shift assays to assess conformational stability

    • Use activity assays when possible to confirm functional integrity

    • Monitor for degradation using SDS-PAGE or Western blot

By implementing these methodological approaches, researchers can maximize the reliability of experiments involving FAM180B recombinant protein and ensure consistent, reproducible results across studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.