Recombinant Human Protein FAM18B2 (FAM18B2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
TVP23C; FAM18B2; Nbla10383; Golgi apparatus membrane protein TVP23 homolog C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TVP23C
Target Protein Sequence
MLQQDSNDDTEDVSLFDAEEETTNRPRKAKIRHPVASFFHLFFRVSAIIVCLLCELLSSS FITCMVTIILLLSCDFWAVKNVTGRLMVGLRWWNHIDEDGKSHWVFESRKESSQENKTVS EAESRIFWLGLIACSVLWVIFAFSALFSFTVKWLRRSRHIAQTGLKVLGSRDPPASAFQS AGITGVSRCPGHPSRKFHQVDINSFTRITDRALYWKPAPRLSSPPLRAAPGNCQQMAPAR LFLSLRLWAWRGGGESPNSRGTGEPGPKFHLASGMH
Uniprot No.

Target Background

Database Links

HGNC: 30453

KEGG: hsa:100533496

STRING: 9606.ENSP00000225576

UniGene: Hs.164595

Protein Families
TVP23 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is FAM18B2 and what is its alternative nomenclature in scientific literature?

FAM18B2 is also known as TVP23C (Trans-Golgi Network Vesicle Protein 23 Homolog C). It belongs to the family with sequence similarity 18, member B2, and has been referred to as hypothetical protein LOC201158 and MGC8763 in some literature . The protein is encoded by the TVP23C gene and functions as a transmembrane protein involved in vesicular transport within the Trans-Golgi network .

What is the amino acid sequence and key structural features of FAM18B2?

The full-length human FAM18B2 protein consists of 276 amino acids with the sequence beginning with MLQQDSNDDT EDVSLFDAEE ETTNRPRKAK . Analysis of the primary sequence reveals transmembrane domains consistent with its role in the Trans-Golgi network. The protein contains hydrophobic regions that anchor it to membranes, along with cytoplasmic domains that likely mediate protein-protein interactions involved in vesicular trafficking .

How is FAM18B2 related to other proteins in its family?

FAM18B2/TVP23C belongs to the broader FAM (Family with sequence similarity) group. While not directly addressed in the search results, related proteins include FAM189A1, FAM189A2, and FAM189B, which are paralog genes of each other . These proteins share sequence homology but have distinct expression patterns and potential functions. FAM189A1 is a CD20-like multiple-pass transmembrane protein required for cell signaling, while FAM189A2 encodes a type-I transmembrane protein primarily expressed at the plasma membrane .

What expression systems are optimal for producing recombinant FAM18B2?

Recombinant FAM18B2 protein can be successfully expressed in both prokaryotic and eukaryotic systems. For applications requiring native post-translational modifications, mammalian expression using HEK-293 cells is preferred . For higher yield applications where post-translational modifications are less critical, E. coli expression systems have been successfully employed . The choice between these systems should be guided by the specific research requirements:

Expression SystemAdvantagesLimitationsOptimal Applications
HEK-293 CellsPost-translational modifications, proper foldingLower yield, higher costStructural studies, interaction analyses
E. coliHigher yield, cost-effective, simpler purificationLimited post-translational modificationsAntibody production, immunization

What purification strategies yield the highest purity of recombinant FAM18B2?

Purification of His-tagged recombinant FAM18B2 is typically achieved using immobilized metal affinity chromatography (IMAC) . The purity can be assessed using SDS-PAGE and Coomassie blue staining, with optimal preparations achieving >80% purity . For applications requiring higher purity, a multi-step purification protocol may be necessary, combining IMAC with size exclusion chromatography or ion exchange chromatography.

How should recombinant FAM18B2 be stored to maintain stability and activity?

According to product specifications, recombinant FAM18B2 should be stored at −20°C and repeated freeze-thaw cycles should be avoided to maintain protein integrity . The protein is typically formulated in PBS with 1M Urea, pH 7.4, which helps maintain solubility and stability . For long-term storage, aliquoting the protein solution prior to freezing is recommended to minimize the number of freeze-thaw cycles.

How should researchers design experiments to study FAM18B2 function?

When designing experiments to investigate FAM18B2 function, researchers should apply rigorous experimental design principles that clearly define variables . For FAM18B2 functional studies:

  • Define clear independent and dependent variables: For example, when studying the effect of FAM18B2 expression on cellular processes, the independent variable would be the level of FAM18B2 expression (overexpression, knockdown, or knockout), while dependent variables might include cellular localization, protein-protein interactions, or cellular phenotypes .

  • Control variables: Maintain consistent cell culture conditions, transfection/transduction efficiency, and protein expression levels across experimental groups .

  • Account for confounding variables: Consider the effect of cell type, passage number, and expression of related proteins that might influence the observed phenotype .

  • Include appropriate positive and negative controls: Use well-characterized proteins with similar localization or function as positive controls, and empty vectors or non-targeting constructs as negative controls .

What methods are most effective for studying FAM18B2 localization and trafficking?

To study FAM18B2 localization and trafficking, researchers should consider these methodological approaches:

  • Fluorescent protein tagging: Generate constructs with fluorescent tags (GFP, mCherry) at either N- or C-terminus, ensuring the tag doesn't interfere with targeting signals.

  • Immunofluorescence microscopy: Use specific antibodies against FAM18B2 or epitope tags for detection in fixed cells.

  • Co-localization studies: Combine FAM18B2 detection with markers for cellular compartments, particularly Trans-Golgi network markers.

  • Live-cell imaging: For dynamic studies of protein trafficking, time-lapse microscopy of fluorescently tagged FAM18B2 can reveal transport kinetics.

  • Subcellular fractionation: Biochemical separation of cellular compartments followed by Western blotting can quantitatively assess the distribution of FAM18B2.

What are the key considerations for antibody generation against FAM18B2?

When generating antibodies against FAM18B2, researchers should consider:

  • Epitope selection: Based on propensity scale analysis of recombinant protein fragments, selecting immunogens with higher propensity scores (>0.48) can significantly improve antibody yield, reducing the fraction of low-responders from 30% to around 10% .

  • Amino acid composition: Avoid immunogen regions with high hydrophobicity and cysteine content, while preferring regions with acidic residues, which contribute positively to immunogenicity .

  • Validation strategy: Plan a multi-modal validation approach including Western blotting, immunoprecipitation, immunofluorescence, and competitive blocking with recombinant protein .

How should researchers analyze expression data for FAM18B2 in disease contexts?

When analyzing FAM18B2 expression in disease contexts, researchers should:

  • Compare multiple datasets: Analyze expression across diverse datasets to establish consistent patterns, similar to the approach used for FAM189B in hepatocellular carcinoma where multiple independent cohorts (TCGA-LIHC, ICGC-LIRI-JP, and GEO datasets) were compared .

  • Perform paired analysis: When possible, compare expression in tumor tissues with matched adjacent normal tissues from the same patients to control for inter-individual variation .

  • Correlate with clinical parameters: Assess associations between FAM18B2 expression and relevant clinical parameters, such as disease stage, grade, or survival outcomes .

  • Consider copy number variations: Analyze whether changes in expression may be attributed to copy number variations, as observed for FAM189B in hepatocellular carcinoma .

What statistical approaches are most appropriate for FAM18B2 functional studies?

Statistical analysis for FAM18B2 functional studies should:

  • Apply multivariate analysis: When examining multiple potential effects of FAM18B2 expression or mutation, use multivariate analysis to account for confounding factors.

  • Perform power calculations: Determine appropriate sample sizes based on expected effect sizes to ensure statistical significance.

  • Use appropriate tests: For comparing expression levels between groups, use paired t-tests for matched samples or Mann-Whitney U tests for non-parametric distributions.

  • Consider multiple testing correction: When performing genome-wide or proteome-wide analyses in conjunction with FAM18B2 studies, apply appropriate corrections for multiple testing to avoid false positives.

How might protein-protein interaction studies reveal FAM18B2 function in the Trans-Golgi network?

To explore FAM18B2 function through protein-protein interactions:

  • Proximity-dependent labeling: Employ BioID or APEX2 fusion proteins to identify proteins in close proximity to FAM18B2 in its native cellular environment.

  • Co-immunoprecipitation followed by mass spectrometry: Use FAM18B2-specific antibodies or epitope-tagged constructs to pull down protein complexes for identification.

  • Yeast two-hybrid screening: Screen for direct interactors using FAM18B2 as bait, though care must be taken with transmembrane proteins.

  • Functional validation: Confirm identified interactions using fluorescence resonance energy transfer (FRET), bimolecular fluorescence complementation (BiFC), or co-localization studies.

  • Interaction mapping: Determine which domains of FAM18B2 mediate specific interactions through truncation or point mutation analysis.

What is the potential role of FAM18B2 in disease progression based on related family members?

While specific information about FAM18B2 in disease is limited, insights can be gained from related family members:

  • Cancer relevance: FAM189B, a related protein, shows significant upregulation in hepatocellular carcinoma and gastric cancer, with high expression correlating with poor prognosis . This suggests potential roles for FAM family members in cancer progression.

  • Pathway involvement: Gene set enrichment analysis of FAM189B indicates associations with cell proliferation and cell cycle pathways , suggesting potential similar involvement for FAM18B2.

  • Genetic association studies: FAM189B's location near the glucosylceramidase gene (linked to Gaucher disease) indicates potential involvement of this protein family in metabolic disorders, warranting investigation of FAM18B2 in similar contexts.

How can CRISPR-Cas9 genome editing advance functional studies of FAM18B2?

CRISPR-Cas9 offers powerful approaches to study FAM18B2 function:

  • Knockout studies: Generate complete knockout cell lines to observe phenotypic consequences and identify essential functions.

  • Knock-in of fluorescent tags: Create endogenously tagged FAM18B2 to study localization and trafficking without overexpression artifacts.

  • Domain-specific mutations: Introduce specific mutations to disrupt predicted functional domains and assess their importance.

  • Promoter modulation: Modify FAM18B2 expression by targeting its promoter or enhancer regions.

  • High-throughput screening: Combine CRISPR-Cas9 with reporter assays to identify pathways affected by FAM18B2 deletion.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.