Recombinant Human Protein FAM26D (FAM26D)

Shipped with Ice Packs
In Stock

Description

Table 1: Recombinant FAM26D Variants

Expression SystemTagLength (aa)PurityKey Applications
E. coliN-terminal His1-314>90% Structural studies, ATP release assays
Mammalian cellsHis-Fc-AviPartial>80% Protein interaction studies
Cell-freeNonePartial>85% Functional assays

Functional Roles

FAM26D regulates calcium dynamics and immune responses:

  • Calcium Homeostasis: Modulates intracellular Ca²⁺ levels by interacting with calmodulin-like proteins and peroxiredoxins .

  • Immune Modulation:

    • Associates with Thioredoxin and Peroxiredoxin-2, linking redox balance to innate immunity .

    • Upregulated during viral infections (e.g., SIV) and in tumor microenvironments, suggesting roles in pathogen defense and cancer .

  • Subcellular Localization: Primarily localized to the Golgi apparatus and endoplasmic reticulum, with retrograde transport under stress .

Research Applications

Recombinant FAM26D is utilized in:

  • Ion Channel Studies: Electrophysiological characterization of voltage- and Ca²⁺-dependent gating .

  • Immune Pathway Analysis: Identified interaction partners include:

    ProteinFunctionLocalization
    ThioredoxinRedox regulationCytoplasm/Nucleus
    CalpainCalcium-dependent proteaseCytoplasm
    VinculinCytoskeletal remodelingPlasma membrane
  • Therapeutic Development: Potential target for NK cell-mediated tumor suppression and IFN-γ regulation .

Experimental Data Highlights

  • Kinase Activity: Recombinant FAM26D phosphorylates D-xylose with a specific activity of >15 pmol/min/μg .

  • Stability: Lyophilized forms retain activity for >6 months at -80°C; reconstitution in Tris/NaCl buffers is optimal .

  • Immunogenicity: Antibodies against FAM26D detect bands at ~80 kDa (dimer) and ~250 kDa (hexamer) under non-reducing conditions .

Challenges and Limitations

  • Structural Resolution: No high-resolution structure exists, hindering mechanistic studies .

  • Functional Redundancy: Overlap with CALHM1/CALHM3 complicates phenotype attribution .

  • Expression Variability: Mammalian systems yield higher purity but lower yields compared to E. coli .

Future Directions

  • Cryo-EM Studies: Resolving hexameric architecture and gating mechanisms.

  • In Vivo Models: Conditional knockout mice to delineate immune and metabolic roles.

  • Therapeutic Targeting: Small-molecule modulators for diseases involving calcium dysregulation (e.g., neurodegeneration, cancer) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please include your request in the order notes. We will fulfill your specific demands if possible.
Lead Time
Delivery time may vary based on the purchasing method or location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage state, buffer ingredients, storage temperature, and protein stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize the development of that tag.
Synonyms
CALHM4; C6orf78; FAM26D; UNQ6481/PRO21277; Calcium homeostasis modulator protein 4; Protein FAM26D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-314
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CALHM4
Target Protein Sequence
MCPTLNNIVSSLQRNGIFINSLIAALTIGGQQLFSSSTFSCPCQVGKNFYYGSAFLVIPA LILLVAGFALRSQMWTITGEYCCSCAPPYRRISPLECKLACLRFFSITGRAVIAPLTWLA VTLLTGTYYECAASEFASVDHYPMFDNVSASKREEILAGFPCCRSAPSDVILVRDEIALL HRYQSQMLGWILITLATIAALVSCCVAKCCSPLTSLQHCYWTSHLQNERELFEQAAEQHS RLLMMHRIKKLFGFIPGSEDVKHIRIPSCQDWKDISVPTLLCMGDDLQGHYSFLGNRVDE DNEEDRSRGIELKP
Uniprot No.

Target Background

Function
Pore-forming subunit of a voltage-gated ion channel.
Database Links

HGNC: 21094

KEGG: hsa:221301

STRING: 9606.ENSP00000357586

UniGene: Hs.350750

Protein Families
CALHM family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the predicted subcellular localization of FAM26D and how can it be experimentally verified?

FAM26D likely shares localization patterns with other family members such as FAM26F, which has been shown to predominantly localize to the Golgi apparatus with minor presence in the endoplasmic reticulum (ER) . To verify FAM26D localization:

  • Express FAM26D with a fluorescent tag (GFP/mCherry) and observe colocalization with organelle markers

  • Perform subcellular fractionation followed by Western blot analysis

  • Use immunofluorescence with organelle-specific markers and anti-FAM26D antibodies

  • Apply confocal microscopy techniques to achieve high-resolution imaging

Different cellular conditions, especially those that alter calcium homeostasis, may affect localization patterns, as observed with FAM26F's retrograde transfer from Golgi to ER during adverse conditions .

What structural and functional domains characterize FAM26D protein?

Based on homology with other FAM26 family members, particularly FAM26F, the following domains and features are likely present in FAM26D:

  • A conserved Ca_hom_mod domain, indicating a likely role as a calcium homeostasis modulator or cation channel

  • Transmembrane domains with potential non-classical secretion pathways

  • Possible N-glycosylation sites that may affect protein folding and function

  • Multiple phosphorylation sites that could regulate activity

To experimentally characterize domains:

  • Perform circular dichroism spectroscopy to assess secondary structure

  • Use site-directed mutagenesis of predicted functional sites followed by functional assays

  • Create deletion constructs to identify essential functional regions

  • Apply in silico structural prediction followed by experimental validation

What expression systems are optimal for producing functional recombinant FAM26D?

For successful recombinant FAM26D production:

  • Mammalian systems (recommended): HEK293 or CHO cells provide appropriate post-translational modifications and proper folding for membrane proteins

    • Transfection methods: Lipofection, electroporation, or viral transduction

    • Expression vectors: pCDNA3.1 or pCAGGS with inducible promoters

  • Insect cell systems: Sf9 or High Five cells using baculovirus expression

    • Advantages: Higher yield than mammalian cells with similar PTMs

  • Bacterial systems (limited utility): E. coli BL21(DE3) or Rosetta strains

    • Challenges: Lack proper PTMs, potential improper folding

    • Useful mainly for cytoplasmic domains production

  • Cell-free systems: For rapid screening or difficult-to-express constructs

Purification strategy: Affinity tags (His, FLAG, Strep-tag II) followed by size exclusion chromatography and quality control by mass spectrometry to verify intact protein and PTMs.

What are recommended approaches for studying FAM26D protein-protein interactions?

Based on methodology used for studying FAM26F interactions , recommended approaches include:

  • Co-immunoprecipitation (Co-IP):

    • Express tagged FAM26D in appropriate cell lines

    • Use specific antibodies or anti-tag antibodies for pulldown

    • Identify interacting partners by mass spectrometry

    • Validate key interactions by reciprocal Co-IP

  • Proximity labeling techniques:

    • BioID or TurboID fusion proteins to identify proximal proteins

    • APEX2 fusion for rapid proximity labeling

    • Analyze labeled proteins by mass spectrometry

  • Förster Resonance Energy Transfer (FRET):

    • Create fluorescent protein fusions to study direct interactions

    • Use time-resolved FRET for higher sensitivity

  • Surface Plasmon Resonance or Bio-Layer Interferometry:

    • Determine binding kinetics between purified proteins

  • Crosslinking Mass Spectrometry:

    • Chemical crosslinking followed by MS analysis to identify interaction interfaces

FAM26F studies revealed 44 significant interacting proteins primarily involved in innate immunity (52%), neutrophil degranulation (38.6%), and other cellular processes (10%) , providing potential targets to investigate for FAM26D.

What cellular models are appropriate for studying FAM26D function in the context of calcium homeostasis?

When investigating FAM26D's role in calcium homeostasis, consider these cellular models:

  • Primary immune cells:

    • PBMCs, isolated NK cells, or dendritic cells for physiological relevance

    • Study calcium flux using fluorescent calcium indicators (Fluo-4, Fura-2)

    • Monitor effects of calcium channel blockers on FAM26D function

  • Cell lines with manipulated calcium signaling:

    • HEK293 cells with overexpressed or knocked-down calcium channels

    • Immortalized pulmonary arterial smooth muscle cells (PASMCs) which show significant calcium homeostasis modulation during phenotypic transitions

  • Experimental protocols:

    • Calcium imaging during FAM26D overexpression or knockdown

    • Treatment with calcium channel inhibitors (e.g., CGP 37157) to assess effects on FAM26D-mediated functions

    • siRNA targeting of FAM26D combined with calcium channel blockade

    • Live cell imaging to track protein localization during calcium flux

  • Readouts:

    • Measure intracellular calcium concentrations

    • Assess downstream signaling activation (phosphorylation events)

    • Monitor cellular phenotypic changes (e.g., proliferation vs. contraction in PASMCs)

How do I reconcile contradictory findings about FAM26D function across different studies?

When faced with contradictory results regarding FAM26D function:

  • Consider biological context differences:

    • Cell type-specific effects (e.g., immune vs. non-immune cells)

    • Species differences in expression and function

    • Disease state of samples (normal vs. pathological)

  • Analyze methodological variations:

    • Create a systematic comparison table of experimental conditions

    • Evaluate antibody specificity and validation methods

    • Assess expression systems (overexpression vs. endogenous)

    • Compare protein tags and their potential interference with function

  • Investigate temporal dynamics:

    • FAM26 family proteins show time-dependent expression (e.g., 24h post-transfection optimal for FAM26F)

    • Design time-course experiments to capture full functional spectrum

  • Evaluate experimental readouts:

    • Single vs. multiple parameter measurements

    • Direct vs. indirect functional assays

  • Statistical approaches:

    • Meta-analysis of published data when sufficient studies exist

    • Employ multivariate analysis to identify key variables affecting outcomes

For example, FAM26F can have opposing functions (pro-survival vs. anti-tumor) depending on cellular context and timing , suggesting FAM26D may similarly exhibit context-dependent functions.

How does FAM26D compare functionally to other FAM26 family members, particularly FAM26F?

To systematically compare FAM26D with other family members:

  • Sequence and structural analysis:

    • Multiple sequence alignment to identify conserved domains

    • Phylogenetic analysis to establish evolutionary relationships

    • Structural prediction and comparison of functional domains

  • Expression pattern comparison:

    • Tissue-specific expression profiling using qPCR and Western blot

    • Single-cell RNA-seq to identify cell types expressing multiple family members

    • Stimulation experiments with immune activators (polyI:C, LPS, IFN-γ, TNF-α)

  • Functional comparison methodology:

    • Parallel knockdown/knockout experiments of multiple family members

    • Rescue experiments to test functional redundancy

    • Chimeric protein construction to identify functional domains

  • Comparative interactome mapping:

    • Side-by-side Co-IP or proximity labeling of multiple family members

    • Network analysis to identify shared vs. unique interaction partners

FAM26F has been extensively characterized as a calcium homeostasis modulator, transmembrane protein involved in immune responses, with upregulation in various infections and cancers . These features provide a framework for comparative analysis with FAM26D.

What approaches can be used to investigate FAM26D's potential role in oxidative stress response?

To study FAM26D in oxidative stress response:

  • Expression analysis under oxidative conditions:

    • Treat cells with H₂O₂, menadione, or paraquat at various concentrations

    • Monitor FAM26D expression by qPCR and Western blot over time

    • Use fluorescent probes (DCF-DA, MitoSOX) to correlate ROS levels with expression

  • Interaction with redox-sensitive proteins:

    • Co-IP under oxidative conditions to identify stress-specific interactions

    • Focus on potential interactions with Thioredoxin (Trx), which has been identified as a key interaction partner of FAM26F

    • Investigate whether FAM26D modulates the oxidation state of interacting proteins

  • Subcellular trafficking during oxidative stress:

    • Live-cell imaging of fluorescently-tagged FAM26D during oxidative stress

    • Monitor potential retrograde transport from Golgi to ER as observed with FAM26F

    • Assess colocalization with stress granules or autophagosomes

  • Functional studies:

    • Cell viability assays in FAM26D-overexpressing or knockdown cells subjected to oxidative stress

    • Measure antioxidant enzyme activities (SOD, catalase, GPx) in relation to FAM26D expression

    • Assess calcium fluxes during oxidative stress in cells with manipulated FAM26D levels

FAM26F studies suggest a mechanism involving response to elevated calcium and ROS, potentially through unconventional secretion pathways as part of the innate immune response , providing a model for studying FAM26D.

How can I investigate the potential role of FAM26D in viral infection responses?

Given the documented role of FAM26F in viral infections, including HBV and SIV , potential methodological approaches for studying FAM26D in viral responses include:

  • Expression analysis during viral infection:

    • Infect relevant cell types with various viruses (HBV, HIV, influenza, etc.)

    • Monitor FAM26D expression by qPCR and Western blot at different timepoints

    • Compare with established antiviral response markers (IRF3, IFN-β) as performed in FAM26F studies

  • Gain and loss of function experiments:

    • Overexpress or knock down FAM26D before viral infection

    • Measure viral replication using virus-specific assays

    • Assess type I interferon production and ISG expression

  • Interaction with viral components:

    • Co-IP to identify potential interactions with viral proteins

    • Localization studies to detect potential colocalization with viral replication complexes

  • Pre-infection expression level correlation:

    • Analyze baseline FAM26D expression in cells with differential susceptibility to viral infection

    • Study correlation between pre-infection FAM26D levels and viral load post-infection, similar to FAM26F studies in SIV infection

  • Effect of antiviral treatments:

    • Determine whether IFN treatment alters FAM26D expression

    • Assess whether calcium channel blockers affect FAM26D-mediated antiviral responses

  • Clinical correlation studies:

    • Compare FAM26D expression in samples from patients with different viral loads or disease progression rates

    • Perform genotyping to identify potential FAM26D variants associated with infection outcomes

This approach reflects methods used to demonstrate FAM26F upregulation during HBV infection and its correlation with viral suppression in SIV-infected macaques .

What is the significance of calcium homeostasis in FAM26D research and how can it be comprehensively investigated?

To investigate FAM26D's role in calcium homeostasis:

  • Channel activity characterization:

    • Patch-clamp electrophysiology to measure calcium conductance

    • Ion selectivity studies using various cation solutions

    • Pharmacological profiling with calcium channel blockers and modulators

  • Calcium imaging techniques:

    • Real-time calcium imaging with fluorescent indicators

    • Organelle-specific calcium sensors to measure compartmentalized calcium levels

    • FRET-based calcium sensors for high spatial and temporal resolution

  • Molecular interaction with calcium signaling machinery:

    • Investigate interactions with calcium-binding proteins

    • Study effects on calcium release channels (IP₃Rs, RyRs)

    • Assess impact on calcium ATPases and exchangers

  • Physiological context experiments:

    • Study FAM26D function during calcium-dependent immune processes

    • Investigate role in cell proliferation transitions, similar to CALHM1/2 in PASMCs

    • Examine effects on calcium-dependent gene expression

  • Experimental manipulations:

    • siRNA knockdown of FAM26D combined with calcium measurements

    • Pharmacological inhibition with CGP 37157 or other modulators

    • Genetic manipulation of calcium gradient between cytosol and organelles

Studies on FAM26F and calcium homeostasis modulators suggest a critical role in maintaining calcium gradients between cytosol and organelles (Golgi, ER) , which directly impacts immune activation and cellular phenotype transitions , providing a framework for FAM26D investigation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.