Recombinant Human Protein FAM26E (FAM26E)

Shipped with Ice Packs
In Stock

Description

Biophysical and Functional Properties

FAM26E functions as a voltage- and calcium-regulated ion channel with broad permeability to cations and signaling molecules like ATP . Key findings include:

  • Voltage gating: Activation at depolarized membrane potentials, modulated by extracellular Ca²⁺ ([Ca²⁺]₀) .

  • Ion selectivity: Poor discrimination among cations (e.g., Ca²⁺, Na⁺) and anions, enabling Ca²⁺ influx and ATP release .

  • Regulatory mechanism: Extracellular Ca²⁺ acts as an allosteric modulator, reducing channel open probability at physiological concentrations (~1.5 mM) .

Table 2: Functional Comparisons with CALHM1

PropertyFAM26E (CALHM5)CALHM1
Tissue ExpressionLimited data; potential neural rolesBrain, taste buds
Pore Diameter~14 Å (predicted)~14 Å (confirmed)
Physiological RoleUnder investigationNeuronal excitability, ATP release

Research Applications and Recombinant Variants

Recombinant FAM26E is widely used for mechanistic studies and antibody validation. Key variants include:

  • Full-length constructs: Expressed in mammalian systems (e.g., HEK293) with tags (His, Fc-Avi) for purification .

  • Control fragments: Truncated proteins (e.g., aa 218–309) for blocking experiments in immunohistochemistry (IHC) and Western blotting (WB) .

Table 3: Available Recombinant FAM26E Products

Expression SystemTagPurityApplicationsSource
Mammalian Cells (HEK293)His, Fc-Avi>80%Structural studies, assaysCreative BioMart
E. coliHis>90%Antibody validationThermo Fisher

Research Findings and Pathways

  • Cation channel activity: FAM26E interacts with TRPM1, ASIC3, and CALHM2/3 in cation transport pathways .

  • Pathway associations: Implicated in calcium signaling and neuronal excitability, though specific pathways remain under investigation .

  • Disease links: Polymorphisms in CALHM1 (a homolog) correlate with Alzheimer’s disease onset, suggesting potential neurodegenerative roles for CALHM5 .

Key Reagents and Tools

  • Antibodies: Validated for WB, IHC, and flow cytometry (e.g., ABIN651998, ABIN1812617) .

  • Interacting proteins: Co-immunoprecipitation studies suggest associations with dynein and exocyst complex components .

Challenges and Future Directions

  • Structural resolution: No high-resolution structures exist, limiting mechanistic insights .

  • Physiological validation: Most data derive from heterologous expression systems; native tissue roles require further exploration .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is preferred, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For working aliquots, store at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please communicate them to us, and we will prioritize developing the specified tag.
Synonyms
CALHM5; C6orf188; FAM26E; Calcium homeostasis modulator protein 5; Protein FAM26E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CALHM5
Target Protein Sequence
MDAFQGILKFFLNQKTVIGYSFMALLTVGSERLFSVVAFKCPCSTENMTYGLVFLFAPAW VLLILGFFLNNRSWRLFTGCCVNPRKIFPRGHSCRFFYVLGQITLSSLVAPVMWLSVALL NGTFYECAMSGTRSSGLLELICKGKPKECWEELHKVSCGKTSMLPTVNEELKLSLQAQSQ ILGWCLICSASFFSLLTTCYARCRSKVSYLQLSFWKTYAQKEKEQLENTFLDYANKLSER NLKCFFENKRPDPFPMPTFAAWEAASELHSFHQSQQHYSTLHRVVDNGLQLSPEDDETTM VLVGTAHNM
Uniprot No.

Target Background

Function
Pore-forming subunit of a voltage-gated ion channel.
Database Links

HGNC: 21568

KEGG: hsa:254228

UniGene: Hs.105081

Protein Families
CALHM family
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.