Recombinant Human Protein FAM26F (FAM26F)

Shipped with Ice Packs
In Stock

Description

Immune-Modulatory Roles

FAM26F is central to immune cell communication and antiviral responses:

Mechanisms of Action

FAM26F regulates immune activation through:

  1. Cation Transport: Acts as a Ca²⁺ channel, influencing intracellular calcium signaling critical for NADPH oxidase activation and respiratory burst .

  2. Redox Regulation: Interacts with Thioredoxin to balance reactive oxygen species (ROS) and maintain cellular redox homeostasis .

  3. Cell-Cell Interactions: Facilitates homophilic interactions between NK cells, dendritic cells, T cells, and macrophages .

Pathway Involvement

PathwayRole of FAM26FSource
TLR3/TLR4 SignalingUpregulated by polyI:C and LPS, synergizing with IFN-β and STAT1 activation.
IFN-γ SignalingStrongly induced by IFN-γ, correlating with plasma IFN-γ levels in vivo.
Antiviral DefenseModulates IRF3 and IFN-β expression, critical for early viral suppression.

Viral Infections

  • HBV Infection: FAM26F expression is downregulated in infected cells but upregulated by ROS/calcium inhibitors (NAC, EGTA-AM). Proposed as an early predictive marker for HBV .

  • SIV Infection: Pre-infection FAM26F levels in macaques inversely correlate with plasma viral load during acute phases, highlighting its role in innate immune priming .

Cancer and Transplantation

  • Tumor Microenvironment: Synergistic expression on NK cells and dendritic cells enhances tumor-specific cytotoxicity, positioning FAM26F as a therapeutic target for NK-sensitive cancers .

  • Transplant Rejection: Differential expression observed in liver/heart transplant patients, suggesting a role in immune tolerance .

Clinical Applications

ApplicationEvidenceSource
Cancer TherapyTargeting FAM26F-expressing NK-dendritic cell synapses to enhance tumor killing.
Viral DiagnosticsPre-infection FAM26F levels predict SIV/HIV replication dynamics.
Immune MonitoringBiomarker for IFN-γ-driven responses in infections and autoimmunity.

Challenges

  • Mechanistic Gaps: Exact pathways linking FAM26F to ROS/calcium regulation remain unclear.

  • Protein Detection: Lack of validated antibodies for human FAM26F limits clinical translation .

Future Directions

  1. Structural Studies: Elucidate FAM26F-Trx interaction dynamics using cryo-EM.

  2. Therapeutic Optimization: Design agonists/antagonists targeting FAM26F for cancer and viral therapies.

  3. Biomarker Validation: Prospective studies to confirm FAM26F as a predictive marker in HBV/HIV.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
CALHM6; C6orf187; FAM26F; Calcium homeostasis modulator protein 6; Protein FAM26F
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-315
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CALHM6
Target Protein Sequence
MEKFRAVLDLHVKHHSALGYGLVTLLTAGGERIFSAVAFQCPCSAAWNLPYGLVFLLVPA LALFLLGYVLSARTWRLLTGCCSSARASCGSALRGSLVCTQISAAAALAPLTWVAVALLG GAFYECAATGSAAFAQRLCLGRNRSCAAELPLVPCNQAKASDVQDLLKDLKAQSQVLGWI LIAVVIIILLIFTSVTRCLSPVSFLQLKFWKIYLEQEQQILKSKATEHATELAKENIKCF FEGSHPKEYNTPSMKEWQQISSLYTFNPKGQYYSMLHKYVNRKEKTHSIRSTEGDTVIPV LGFVDSSGINSTPEL
Uniprot No.

Target Background

Function
FAM26F is a pore-forming subunit of a voltage-gated ion channel.
Gene References Into Functions
  1. FAM26F is a conserved, signal peptide-deprived transmembrane protein that is secreted through a non-classical pathway. FAM26F possesses an immunoglobulin-like fold, highlighting its role in immune responses. PMID: 27784631
  2. FAM26F was consistently and significantly overexpressed in ulcerative colitis patients. PMID: 25082827
Database Links

HGNC: 33391

KEGG: hsa:441168

UniGene: Hs.381220

Protein Families
CALHM family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and cellular localization of FAM26F?

FAM26F is a 315 amino acid long protein with a molecular weight of 34.258 kDa. It contains 3-5 transmembrane helices and an immunoglobulin-like fold that underscores its role in immune functions . Immunofluorescence and confocal microscopy studies have revealed that FAM26F is predominantly localized within the Golgi apparatus, with minor presence in the endoplasmic reticulum (ER) . This dual localization pattern suggests potential retrograde transfer of FAM26F from Golgi to ER during adverse cellular conditions . The protein lacks a signal peptide but is secreted through non-classical pathways, which is consistent with its immune modulatory functions .

What are the primary functions of FAM26F in the immune system?

FAM26F plays critical roles in modulating diverse immune responses. Initially identified as INAM (IRF-3-dependent natural killer-activating molecule), FAM26F mediates myeloid dendritic cell (mDC)-natural killer (NK) cell contact-dependent activation . Functional characterization studies have revealed that approximately 52% of FAM26F's interacting proteins are involved in innate immunity, 38.6% in neutrophil degranulation, and the remaining 10% participate in phosphorylation, degradation, or regulation of apoptosis . Importantly, FAM26F has been implicated in calcium homeostasis, as indicated by its alternative name CALHM6, which is crucial for immune cell signaling and function .

How is FAM26F expression regulated in immune cells?

FAM26F expression is dynamically regulated in response to various immune stimuli. Studies have shown that FAM26F RNA levels are upregulated following IFN-γ treatment, with an average 40-fold increase in lymphocytes after in vitro exposure . Additionally, FAM26F is upregulated by several other immune stimulants including polyI:C, LPS, TNF-alpha, and through pathways involving TLR3, TLR4, IFN-β, and Dectin-1 . While baseline FAM26F expression appears stable over months in individuals, the expression levels can vary up to tenfold between different subjects . This variability suggests both constitutive and inducible regulatory mechanisms controlling FAM26F expression.

What methodologies are most effective for studying FAM26F protein interactions?

For investigating FAM26F protein interactions, co-immunoprecipitation (co-IP) coupled with mass spectrometry (MS/MS) has proven highly effective . This approach identified 85 proteins interacting with FAM26F, of which 44 were found to significantly copurify with it . For validation of specific interactions, techniques such as reciprocal co-IP, proximity ligation assays, or FRET (Fluorescence Resonance Energy Transfer) are recommended to confirm direct protein-protein interactions.

When specifically investigating the critical interaction between FAM26F and Thioredoxin, researchers should employ controlled experimental conditions that account for cellular redox states, as this interaction appears to be modulated under stress or disease conditions . Additionally, mutational analysis targeting the immunoglobulin-like fold domain can provide insights into the structural requirements for these protein interactions.

How can researchers effectively measure FAM26F-mediated calcium flux in experimental systems?

Given FAM26F's role in calcium homeostasis, measuring calcium flux is crucial for functional studies. Recommended methodologies include:

  • Live-cell calcium imaging using fluorescent calcium indicators (Fluo-4 AM or Fura-2)

  • Patch-clamp electrophysiology to directly measure calcium currents

  • CRISPR-Cas9 mediated knockout or knockdown approaches to establish the specific contribution of FAM26F to calcium homeostasis

When designing these experiments, researchers should consider that FAM26F functions in concert with the inositol 1,4,5-trisphosphate (IP3) pathway . As evidenced by pathway analysis, FAM26F influences calcium release from intracellular stores (ER and Golgi) through activation of IP3 receptors . Control experiments should include specific inhibitors of canonical calcium channels to isolate FAM26F-specific effects.

What are the best experimental approaches to investigate FAM26F's role in NK cell activation?

To effectively study FAM26F's role in NK cell activation, researchers should employ co-culture systems with myeloid dendritic cells (mDCs) and NK cells, as the synergistic expression of FAM26F on both cell types appears necessary for optimal NK cell activation .

Recommended experimental design should include:

  • FAM26F overexpression and knockdown in both mDCs and NK cells

  • Transwell assays to distinguish contact-dependent from soluble factor-mediated effects

  • Analysis of NK cell activation markers (CD69, NKG2D) and functional assays (cytotoxicity, IFN-γ production)

  • Investigation of the interaction between FAM26F's cytoplasmic tail and downstream signaling components

Importantly, researchers should monitor the expression and interaction of FAM26F with CD30R, as this interaction appears to be a critical determinant of whether immune responses are activated or inhibited .

How can FAM26F expression levels be used as a prognostic marker in viral infections?

For implementing FAM26F as a prognostic marker:

  • Baseline FAM26F expression should be measured in PBMCs prior to infection or at early infection stages

  • qRT-PCR is the recommended method for quantifying FAM26F transcript levels

  • Analysis should account for individual variation in baseline expression (up to tenfold differences have been observed)

  • FAM26F expression data should be considered alongside other established markers like MHC typing for comprehensive prognostic evaluation

The inverse correlation between pre-infection FAM26F levels and viral load (area under the curve) was particularly strong in non-vaccinated subjects (P<0.0001, rs=-0.89, n=16) and still significant but less pronounced in vaccinated subjects (P=0.033, rs=-0.43, n=25) .

What mechanisms explain FAM26F's role in oxidative stress responses and its interaction with Thioredoxin?

FAM26F interacts with Thioredoxin (Trx) as part of a complex cellular response to oxidative stress . The mechanism involves several coordinated steps:

  • Immune cell activation or stress triggers calcium influx as a primary signaling response

  • Increased cytosolic calcium activates protein kinase C, which subsequently activates NADPH oxidase

  • NADPH oxidase generates reactive oxygen species (ROS)

  • Cytosolic calcium employs dual mechanisms to modulate oxidative response:

    • Activating NADPH oxidase respiratory burst

    • Inducing oxidation of Thioredoxin

The oxidized Trx detoxifies ROS and maintains the reduced cellular environment . Under stress conditions, the Trx1/TrxR1 system can either migrate to the nucleus to induce transcription of specific genes or be secreted through unconventional routes to contribute to extracellular immune networks .

This FAM26F-Trx interaction appears to be a critical regulatory junction that determines whether immune responses are activated or suppressed, particularly through their competitive interaction with CD30R .

How does FAM26F contribute to neutrophil degranulation, and what experimental models best capture this function?

Based on interaction data showing that 38.6% of FAM26F-interacting proteins are involved in neutrophil degranulation , researchers investigating this function should consider:

  • Human or mouse neutrophil isolation and stimulation models

  • FAM26F knockout or knockdown approaches using CRISPR-Cas9 or siRNA

  • Measurement of degranulation markers (myeloperoxidase, elastase, lactoferrin)

  • Calcium flux measurements during neutrophil activation

  • Analysis of signaling pathways downstream of FAM26F activation

Flow cytometry analysis of degranulation markers combined with confocal microscopy to track granule movement provides comprehensive insights into FAM26F's role in this process. Researchers should account for the calcium-dependent nature of neutrophil degranulation when designing experiments, as FAM26F's influence on calcium homeostasis likely mediates its effects on this process .

What are common challenges in expressing recombinant FAM26F protein, and how can they be addressed?

Expressing recombinant FAM26F presents several challenges due to its multi-transmembrane structure. Based on experimental procedures from successful studies , researchers should consider:

  • Expression system selection: HEK293 cells have been successfully used for FAM26F expression, providing proper folding and post-translational modifications

  • Optimization of transfection timing: Cell viability assays indicate that maximum FAM26F expression occurs at 24 hours post-transfection, after which viability decreases

  • Solubilization challenges: As a membrane protein, FAM26F requires careful selection of detergents for extraction

  • Tag position considerations: C-terminal tags (such as GFP) have been successfully employed without disrupting function

  • Confirmation of proper folding: Verify protein folding through functional assays that measure calcium flux or protein interactions

When experiencing low expression yields, researchers should verify transfection efficiency using reporter plasmids and consider codon optimization for the expression system being used.

How can researchers differentiate between direct and indirect effects of FAM26F on immune cell activation?

Distinguishing direct from indirect effects of FAM26F requires carefully designed control experiments:

  • Generate FAM26F mutants lacking specific domains (particularly the cytoplasmic tail implicated in signaling)

  • Use domain-specific blocking antibodies to inhibit particular functions

  • Employ proximity labeling techniques (BioID or APEX) to identify proteins directly interacting with FAM26F in living cells

  • Conduct time-course experiments to establish the sequence of signaling events

  • Utilize super-resolution microscopy to visualize the spatial organization of FAM26F and its interaction partners during immune cell activation

The critical interaction between FAM26F and Thioredoxin should be specifically examined, as this appears to be a key regulatory node that determines downstream immune activation or inhibition .

What are the most promising therapeutic applications of targeting the FAM26F pathway?

Given FAM26F's roles in immune regulation, several therapeutic applications warrant investigation:

  • NK cell-based cancer immunotherapy: FAM26F's role in NK cell activation against tumors via its cytoplasmic tail suggests potential for enhancing NK-sensitive tumor targeting

  • Viral infection management: The inverse correlation between FAM26F levels and viral load indicates potential for modulating FAM26F expression to enhance antiviral responses

  • Autoimmune disease interventions: Targeting the FAM26F-Thioredoxin-CD30R interaction axis may provide novel approaches to modulate overactive immune responses

  • Calcium homeostasis regulation: As CALHM6, FAM26F's role in calcium signaling offers potential therapeutic targets for diseases involving calcium dysregulation

Researchers should explore small molecule modulators of FAM26F function, particularly those that could enhance its NK-activating properties in cancer immunotherapy contexts.

What is the relationship between FAM26F and other members of the FAM26/CALHM family, and how might their functions be coordinated?

FAM26F/CALHM6 belongs to a family of calcium homeostasis modulators, suggesting coordinated functions among family members. Future research should address:

  • Comparative analysis of expression patterns across family members in different tissues and immune cell subsets

  • Investigation of potential heteromeric channel formation between FAM26F and other family members

  • Evolutionary conservation analysis to identify core functional domains versus specialized domains

  • Potential compensatory mechanisms when one family member is deficient

Understanding the relationship between FAM26F and related proteins may reveal broader regulatory networks controlling calcium homeostasis and immune function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.