Recombinant Human Protein FAM73A (FAM73A)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Protein FAM73A

Recombinant Human Protein FAM73A, also known as Mitoguardin 1 or MIGA1, is a protein encoded by the FAM73A gene in humans. It plays a crucial role in mitochondrial function, particularly in regulating mitochondrial fusion by forming homo- and heterodimers at the mitochondrial outer membrane. This process facilitates the formation of PLD6/MitoPLD dimers, which may be involved in phospholipid metabolism regulation via PLD6/MitoPLD .

Research Findings and Applications

Recent studies have highlighted the significance of FAM73A in cancer research. For instance, circular RNA circFAM73A, derived from the FAM73A gene, has been shown to promote cancer stem cell-like properties in gastric cancer by regulating HMGA2 expression and enhancing β-catenin stability . This suggests that FAM73A and its related circular RNAs could serve as potential biomarkers or therapeutic targets in cancer.

Recombinant Protein Production and Use

Recombinant proteins like FAM73A are produced through genetic engineering, where the gene of interest is inserted into a host organism for expression. These proteins are widely used in research for studying protein interactions, enzyme activities, and cellular responses. They can also serve as standards or controls in immunostaining assays .

Table 2: Applications of Recombinant Proteins

ApplicationDescription
Protein InteractionsInvestigate interactions with other proteins or ligands
Enzyme ActivitiesStudy enzyme functions and kinetics
Cellular ResponsesExamine effects on cell growth, differentiation, and signaling pathways
Immunostaining AssaysUsed as standards or controls for detecting specific proteins

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MIGA1; FAM73A; Mitoguardin 1; Protein FAM73A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-632
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
MIGA1
Target Protein Sequence
MSDCCSAPGISWEAGVGRPAVPGLELQIRRGAMSEETVSESQFSLKTAALRVFDLPLTWY YSLSQIKFSPVAKKLFVVTAVSAISVIFLAHHFKRKRGKKKGKILPWEPEHLILEYTKRA ASDKGSSCSSSRQNLTLSLSSTKDKGSQVCNYANGGLFSKYSGSAQSLASVQSVNSCHSC ACGNSNSWDKADEDDIKLVNIPVTTPENLYLMGMELFEEALRRWEQALTFRNRQAEDEAC GSIKLGAGDAIAEENVDDIISTEFIHKLEALLQRAYRLQEEFEATLGASDPNSLADDIDK DTDITMKGNVEDFGLRDTLSIASTDSFASAAELAEHREVRHTYSLESLCHCPFYEEAMHL VEEGKIYSRVLRTEMLECLGDSDFLAKLHCIRQAFQVILSESANRIFLAESGRKILSALI VKARKNPKKFEDVFDEMIYFLEQTDHWGSTEMELAARGVKNLNFYDVVLDFILMDSFEDL ENPPTSIQNVVNNRWLNSSFKETAVASSCWSVLKQKRQQMKIPDGFFAHFYAICEHISPV LAWGFLGPRNSLYDLCCFFKNQVLLFLKDIFDFEKVRYSSTETLAEDLMQLLIRRTELLM AYLEADALRHTSSCLSSHGHVMSTGLLEAKVQ
Uniprot No.

Target Background

Function
FAM73A (Mitochondrial Import Protein) is a regulator of mitochondrial fusion. It functions by forming homo- and heterodimers at the mitochondrial outer membrane, facilitating the formation of PLD6/MitoPLD dimers. Its role may involve regulating phospholipid metabolism via PLD6/MitoPLD.
Gene References Into Functions
  1. MIGA proteins promote mitochondrial fusion by regulating mitochondrial phospholipid metabolism via MitoPLD. PMID: 26711011
Database Links

HGNC: 24741

KEGG: hsa:374986

STRING: 9606.ENSP00000359827

UniGene: Hs.437755

Protein Families
Mitoguardin family
Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein.

Q&A

What is the functional role of FAM73A in cellular processes?

FAM73A, also known as MIGA1 or Mitoguardin 1, functions primarily as a regulator of mitochondrial fusion. Its biological mechanism involves forming both homo- and heterodimers at the mitochondrial outer membrane, which facilitates the formation of PLD6/MitoPLD dimers. Through this activity, FAM73A may regulate phospholipid metabolism via the PLD6/MitoPLD pathway . Methodologically, researchers investigating FAM73A function should consider both mitochondrial morphology analysis and phospholipid metabolism assays to comprehensively understand its cellular impact.

What detection methods are most effective for identifying FAM73A expression in different tissue types?

For effective detection of FAM73A across various human tissues, immunohistochemistry with appropriate antibodies has proven highly successful. Research has demonstrated that FAM73A exhibits distinctive granular cytoplasmic positivity patterns that vary by tissue type:

  • In testis: Moderate granular cytoplasmic positivity specifically in Leydig cells

  • In placenta: Strong granular cytoplasmic positivity in trophoblastic cells

  • In kidney: Moderate granular cytoplasmic positivity in tubular cells

When selecting antibodies, rabbit polyclonal antibodies (such as ab121532) have demonstrated good specificity at dilutions of approximately 1/20 for immunohistochemical applications. For immunofluorescence applications (ICC/IF), similar antibodies can be utilized with appropriate optimization of concentration.

How does FAM73A expression compare across different cell types and disease states?

Expression analysis across multiple cell lines reveals important variations in FAM73A levels. In gastric cancer research, studies have shown that while circular RNA derived from the FAM73A gene (circFAM73A) shows significant upregulation in gastric cancer tissues compared to adjacent normal tissues, the expression of linear FAM73A mRNA itself remains unchanged in certain gastric cancer cell lines such as AGS and SGC7901 . This differential regulation between circular and linear forms of the same gene represents an important consideration for experimental design. Researchers should employ both circular RNA-specific and conventional mRNA detection methods when profiling FAM73A in disease contexts.

What is the relationship between FAM73A and its circular RNA derivative (circFAM73A)?

The relationship between FAM73A and circFAM73A represents a complex regulatory circuit with significant implications for cancer biology. While FAM73A encodes a functional mitochondrial protein, circFAM73A functions through distinct molecular mechanisms:

  • CircFAM73A is formed through back-splicing of the FAM73A gene transcript

  • Unlike linear FAM73A mRNA, circFAM73A demonstrates significantly enhanced stability against RNase R digestion

  • CircFAM73A acts as a miRNA sponge, particularly sequestering miR-490-3p

  • Through a positive feedback mechanism, HMGA2 (regulated by circFAM73A through miR-490-3p) facilitates transcriptional activation of FAM73A via E2F1 and enhances circFAM73A circularization through HNRNPL

For researchers studying either form, it is critical to design experiments that can distinguish between linear and circular transcripts through RNase R treatment followed by RT-qPCR with divergent primers.

What purification approaches yield the highest quality recombinant FAM73A protein?

While specific purification protocols for recombinant FAM73A are not directly detailed in the provided research, effective purification typically employs an immunogen corresponding to recombinant fragment protein within Human MIGA1 aa 250-450 . For optimal results, researchers should consider:

  • Expression in mammalian systems to ensure proper post-translational modifications

  • Inclusion of appropriate solubility tags given FAM73A's membrane association properties

  • Two-step purification combining affinity chromatography followed by size exclusion

  • Validation of purified protein through Western blotting with specific antibodies

  • Functional assessment through mitochondrial binding assays

How does circFAM73A contribute to cancer stem cell-like properties in gastric cancer?

CircFAM73A plays a critical role in promoting cancer stem cell (CSC)-like properties in gastric cancer through multiple molecular mechanisms:

  • MiRNA Regulation Pathway: CircFAM73A functions as a miRNA sponge for miR-490-3p, effectively preventing miR-490-3p from suppressing HMGA2. This leads to increased HMGA2 expression, which promotes stemness properties .

  • Protein Recruitment Mechanism: CircFAM73A directly recruits the protein HNRNPK, which:

    • Enhances interaction between HNRNPK and β-catenin

    • Facilitates β-catenin stabilization

    • Promotes downstream activation of cancer stemness pathways

  • Positive Feedback Loop: A sophisticated regulatory circuit exists wherein:

    • CircFAM73A upregulates HMGA2 by sequestering miR-490-3p

    • HMGA2 enhances E2F1 and HNRNPL activity

    • E2F1 promotes FAM73A transcription

    • HNRNPL increases circFAM73A circularization efficiency

    • This creates a self-reinforcing loop that maintains elevated circFAM73A levels

Experimental data demonstrates that elevated circFAM73A correlates with poor prognosis in gastric cancer patients, suggesting its potential utility as both a prognostic biomarker and therapeutic target .

What methodologies are most effective for studying circFAM73A-mediated regulation in cancer models?

Based on successful approaches documented in the literature, researchers investigating circFAM73A should consider the following methodological pipeline:

  • Expression Analysis:

    • qRT-PCR with divergent primers specific to back-splice junctions

    • RNase R digestion to confirm circular structure (circFAM73A remains stable while linear FAM73A mRNA degrades)

    • Actinomycin D treatment to assess relative stability over time

  • Functional Assessment:

    • RNA interference using specifically designed shRNAs targeting the back-splice junction

    • Sphere formation assays to evaluate cancer stemness

    • Cisplatin resistance assays to assess chemoresistance properties

    • Xenograft models for in vivo validation

  • Molecular Interaction Studies:

    • RNA pulldown assays using biotin-coupled circFAM73A probes

    • Luciferase reporter assays to confirm miRNA binding

    • RNA immunoprecipitation (RIP) to identify protein binding partners

    • RNA fluorescence in situ hybridization (FISH) to visualize cellular localization

These approaches have successfully elucidated circFAM73A's role in gastric cancer and can be adapted for investigations in other cancer types.

What is the significance of FAM73A-BRAF fusion in disease contexts?

The FAM73A-BRAF fusion gene represents an important alternative genetic mechanism for BRAF activation in certain disease contexts, particularly in Langerhans cell histiocytosis (LCH). While the search results provide limited detail on this specific fusion, methodological approaches used to identify and characterize it include:

  • Whole-exome sequencing (WES) to identify candidate fusion events

  • Targeted BRAF gene sequencing to confirm fusion boundaries

  • Transcriptome sequencing (RNA-seq) to validate expression of the fusion transcript

  • Targeted sequencing specifically designed to detect the FAM73A-BRAF fusion

This fusion likely creates a chimeric protein that alters BRAF function, potentially activating downstream MAPK signaling pathways similar to other BRAF alterations in cancer. For researchers studying this fusion, it is critical to establish functional validation through:

  • Expression of the recombinant fusion protein

  • Assessment of kinase activity

  • Evaluation of downstream pathway activation

  • Testing sensitivity to BRAF and MEK inhibitors

How can researchers effectively differentiate between wild-type FAM73A and mutant or fusion variants?

Differentiating between wild-type FAM73A and its variants requires a multi-modal approach:

  • Genetic Detection:

    • PCR with primers spanning expected fusion junctions or mutation hotspots

    • Next-generation sequencing for comprehensive mutational analysis

    • Digital droplet PCR for quantitative assessment of mutation allele frequency

  • Protein-Level Detection:

    • Western blotting with antibodies targeting different regions of FAM73A

    • Immunoprecipitation followed by mass spectrometry

    • Size-exclusion chromatography to separate fusion proteins based on molecular weight differences

  • Functional Assessment:

    • Mitochondrial morphology analysis in cells expressing wild-type vs. variant FAM73A

    • PLD6/MitoPLD dimerization assays

    • Phospholipid metabolism analysis

For fusion proteins specifically, researchers should design experimentation to assess both the activities of the original proteins and any novel functions that may arise from the fusion.

What experimental models best recapitulate FAM73A function in mitochondrial dynamics?

To study FAM73A's role in mitochondrial dynamics, researchers should consider:

  • Cellular Models:

    • Cell lines with endogenous FAM73A expression (validated by Western blot)

    • CRISPR-Cas9 engineered FAM73A knockout cell lines

    • Rescue experiments with wild-type and mutant FAM73A constructs

  • Visualization Techniques:

    • Live-cell imaging with mitochondrial-specific dyes (MitoTracker)

    • Confocal microscopy for high-resolution analysis of mitochondrial morphology

    • Super-resolution microscopy for detailed analysis of FAM73A localization at the mitochondrial outer membrane

  • Functional Assessments:

    • Mitochondrial fusion assays using photoactivatable fluorescent proteins

    • Colocalization studies with PLD6/MitoPLD to assess facilitation of dimer formation

    • Phospholipid metabolism analysis focusing on pathways regulated by PLD6/MitoPLD

These approaches collectively provide comprehensive insights into FAM73A's functional role in mitochondrial dynamics.

What are the most common technical challenges when working with recombinant FAM73A?

Researchers working with recombinant FAM73A frequently encounter several technical challenges:

  • Protein Solubility Issues:

    • As a mitochondrial membrane-associated protein, FAM73A can present solubility challenges

    • Solution: Use mild detergents (0.1% Triton X-100) during extraction and consider fusion tags (MBP or SUMO) to enhance solubility

  • Antibody Specificity Concerns:

    • Cross-reactivity with related proteins (particularly FAM73B/MIGA2)

    • Solution: Validate antibodies using knockout controls and consider using antibodies targeting unique regions (such as aa 250-450 in human MIGA1)

  • Mitochondrial Localization Assessment:

    • Ensuring proper subcellular localization of recombinant constructs

    • Solution: Include appropriate mitochondrial targeting sequences and validate localization through colocalization with established mitochondrial markers

  • Circular RNA vs. Linear mRNA Distinction:

    • Difficulty distinguishing between circFAM73A and linear FAM73A

    • Solution: Implement RNase R treatment before RT-qPCR and use divergent primers specific to the back-splice junction

What control experiments are essential when studying FAM73A's impact on mitochondrial function?

When investigating FAM73A's role in mitochondrial function, the following controls are crucial:

  • Expression Controls:

    • Empty vector controls for overexpression studies

    • Non-targeting siRNA/shRNA for knockdown experiments

    • Rescue experiments with wild-type FAM73A to confirm specificity of knockdown phenotypes

  • Localization Controls:

    • Mitochondrial marker proteins (TOM20, MitoTracker dyes)

    • FAM73A constructs with mutated mitochondrial targeting sequences

    • Subcellular fractionation quality controls

  • Functional Assessment Controls:

    • Positive controls for mitochondrial fusion (MFN1/2 overexpression)

    • Negative controls for mitochondrial fusion (DRP1 overexpression)

    • Time-course assessments to capture dynamic changes

  • Interaction Controls:

    • GST-only controls for pulldown experiments

    • IgG controls for immunoprecipitation

    • Competition assays with unlabeled proteins to confirm specificity

How can contradictory data regarding FAM73A function be reconciled in research settings?

When facing contradictory results regarding FAM73A function, researchers should consider these methodological approaches:

  • Cell Type Specificity Analysis:

    • Compare FAM73A effects across multiple cell types (normal vs. cancer cells)

    • Examine tissue-specific expression patterns (Leydig cells, trophoblastic cells, renal tubular cells)

    • Consider the impact of the cellular microenvironment on FAM73A function

  • Isoform-Specific Investigations:

    • Determine if contradictions arise from studying different FAM73A isoforms

    • Assess the relative abundance of linear vs. circular FAM73A forms

    • Design experiments to isolate effects of specific variants

  • Context-Dependent Regulation:

    • Evaluate FAM73A function under different cellular stresses (hypoxia, nutrient deprivation)

    • Assess interaction with different binding partners across experimental contexts

    • Consider post-translational modifications that might alter function

  • Technical Reconciliation:

    • Standardize experimental conditions across studies

    • Employ multiple complementary techniques to validate findings

    • Consider temporal dynamics in FAM73A function that might explain apparently contradictory snapshots

How might targeting FAM73A or circFAM73A be leveraged for cancer therapeutics?

Based on current understanding of FAM73A biology, several therapeutic strategies show promise:

  • CircFAM73A-Targeted Approaches:

    • Antisense oligonucleotides targeting the back-splice junction

    • siRNAs specifically designed against the unique junction sequence

    • CRISPR-Cas13 systems for targeted RNA degradation

  • Disruption of Regulatory Feedback Loops:

    • Small molecules targeting the HMGA2-E2F1-HNRNPL axis that reinforces circFAM73A expression

    • Compounds that inhibit HNRNPK recruitment by circFAM73A

    • Agents that destabilize the circFAM73A-mediated β-catenin stabilization

  • Combinatorial Approaches:

    • Pairing circFAM73A inhibition with conventional chemotherapeutics like cisplatin

    • Targeting circFAM73A in combination with anti-cancer stem cell therapies

    • Dual inhibition of both circular and linear FAM73A in appropriate contexts

Clinical relevance is supported by findings that elevated circFAM73A predicts poor prognosis in gastric cancer patients, suggesting potential utility as both a prognostic biomarker and therapeutic target .

What biomarker potential does FAM73A expression or mutation status hold?

FAM73A and its derivatives show significant potential as biomarkers in several contexts:

  • CircFAM73A as a Prognostic Indicator:

    • Elevated circFAM73A levels correlate with poor prognosis in gastric cancer patients

    • Potential utility in predicting treatment resistance and cancer recurrence

    • Possible liquid biopsy applications through detection in extracellular vesicles

  • FAM73A-BRAF Fusion as a Diagnostic Marker:

    • Presence of fusion can help identify specific subtypes of Langerhans cell histiocytosis

    • May predict responsiveness to BRAF/MEK inhibitor therapies

    • Potential for development of fusion-specific diagnostic tests

  • Tissue-Specific Expression Patterns:

    • Distinct granular cytoplasmic positivity patterns in different tissues (Leydig cells, trophoblastic cells, renal tubular cells)

    • Potential utility in identifying cell origin in poorly differentiated tumors

    • Application in monitoring treatment response through changes in expression pattern

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.