Recombinant Human Protein FAM73B (FAM73B)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MIGA2; C9orf54; FAM73B; PSEC0112; Mitoguardin 2; Protein FAM73B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-593
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
MIGA2
Target Protein Sequence
MAFRRAEGTSMIQALAMTVAEIPVFLYTTFGQSAFSQLRLTPGLRKVLFATALGTVALAL AAHQLKRRRRRKKQVGPEMGGEQLGTVPLPILLARKVPSVKKGYSSRRVQSPSSKSNDTL SGISSIEPSKHSGSSHSVASMMAVNSSSPTAACSGLWDARGMEESLTTSDGNAESLYMQG MELFEEALQKWEQALSVGQRGDSGSTPMPRDGLRNPETASEPLSEPESQRKEFAEKLESL LHRAYHLQEEFGSTFPADSMLLDLERTLMLPLTEGSLRLRADDEDSLTSEDSFFSATELF ESLQTGDYPIPLSRPAAAYEEALQLVKEGRVPCRTLRTELLGCYSDQDFLAKLHCVRQAF EGLLEDKSNQLFFGKVGRQMVTGLMTKAEKSPKGFLESYEEMLSYALRPETWATTRLELE GRGVVCMSFFDIVLDFILMDAFEDLENPPASVLAVLRNRWLSDSFKETALATACWSVLKA KRRLLMVPDGFISHFYSVSEHVSPVLAFGFLGPKPQLAEVCAFFKHQIVQYLRDMFDLDN VRYTSLPALADDILQLSRRRSEILLGYLGVPAASSAGVNGALPRENGPLGELQ
Uniprot No.

Target Background

Function
FAM73B is a regulator of mitochondrial fusion. It forms homo- and heterodimers at the mitochondrial outer membrane, facilitating the formation of PLD6/MitoPLD dimers. Its function may involve regulating phospholipid metabolism through PLD6/MitoPLD.
Gene References Into Functions
  1. MIGA1/2 proteins promote mitochondrial fusion by regulating mitochondrial phospholipid metabolism via MitoPLD. PMID: 26711011
Database Links

HGNC: 23621

OMIM: 616774

KEGG: hsa:84895

UniGene: Hs.632693

Protein Families
Mitoguardin family
Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.

Q&A

What is FAM73B/MIGA2 and what is its primary cellular function?

FAM73B, also known as MIGA2 (Mitoguardin 2), is a mitochondrial outer membrane protein that plays a crucial role in mitochondrial dynamics, particularly in promoting mitochondrial fusion . This protein is encoded by the Fam73b gene and functions as a key regulator of mitochondrial morphology in various cell types, including immune cells such as macrophages and dendritic cells . The primary cellular function of FAM73B involves maintaining the balance between mitochondrial fusion and fission processes, which are essential for mitochondrial network homeostasis and cellular energy production . Research has demonstrated that FAM73B has a pivotal function in Toll-like receptor (TLR)-regulated mitochondrial morphology switching from fusion to fission, indicating its importance in immune cell responses . Mitochondrial dynamics controlled by proteins like FAM73B are now recognized as critical determinants of cellular metabolism, apoptosis, and signaling pathways that influence various physiological and pathological processes.

How is FAM73B expressed in different tissues and cell types?

FAM73B exhibits variable expression patterns across different tissues and cell types, with notable presence in immune cells such as macrophages and dendritic cells . Based on available research data, FAM73B shows reactivity in both human and mouse tissues, as indicated by antibody reactivity testing . Western blotting analysis has identified FAM73B protein at molecular weights of approximately 70 and 78 kDa, suggesting potential post-translational modifications or isoform variations . In the context of immune cell research, FAM73B expression has been particularly well-characterized in macrophages, where it plays a significant role in regulating mitochondrial dynamics during immune responses . Expression levels may vary under different physiological conditions, with particular alterations observed during inflammatory responses and in tumor microenvironments. The regulation of FAM73B expression appears to be linked to cellular metabolic states and immunological activation signals, making it an important marker for certain cellular conditions and responses to environmental stimuli.

What is the relationship between FAM73B and mitochondrial dynamics?

FAM73B serves as a critical regulator of mitochondrial morphology by promoting mitochondrial fusion, thus maintaining the dynamic balance between fusion and fission events that continually reshape the mitochondrial network . Research has demonstrated that FAM73B is specifically localized to the outer mitochondrial membrane, where it interacts with other mitochondrial dynamics proteins . When cells are stimulated with Toll-like receptor (TLR) agonists, FAM73B plays a pivotal role in the transition from mitochondrial fusion to fission, a process that has significant implications for cellular metabolism and immune function . The ablation of the Fam73b gene results in a shift toward increased mitochondrial fission, which subsequently influences downstream cellular processes including inflammatory cytokine production, particularly IL-12 . This relationship between FAM73B and mitochondrial dynamics extends beyond simple morphological changes, as it affects mitochondrial function, cellular energy production, and even the recruitment of proteins like Parkin to mitochondria, which are involved in mitochondrial quality control and cellular stress responses .

How does FAM73B contribute to immune cell function?

FAM73B significantly influences immune cell function through its regulation of mitochondrial dynamics, which directly impacts cellular metabolism and signaling pathways crucial for immune responses . In macrophages and other innate immune cells, FAM73B's control of mitochondrial fusion-fission balance affects Toll-like receptor (TLR)-mediated inflammatory responses and immune cell polarization . Research has demonstrated that ablation of Fam73b promotes a shift toward mitochondrial fission, which enhances the production of interleukin-12 (IL-12), a key cytokine involved in activating T cells and promoting anti-tumor immunity . This metabolic reprogramming through altered mitochondrial dynamics affects how immune cells respond to pathogens and tumor cells. The connection between FAM73B and immune function extends to tumor-associated macrophages, where FAM73B-mediated mitochondrial dynamics can influence T-cell activation within the tumor microenvironment . These findings highlight FAM73B as a molecular link between cellular metabolism and immune responses, positioning it as a potential target for immunomodulatory therapies.

What are the optimal methods for detecting and quantifying FAM73B expression in experimental systems?

For reliable detection and quantification of FAM73B expression, researchers should employ a multi-faceted approach combining protein and mRNA analysis techniques. Western blotting represents a primary method for protein detection, with optimal antibody dilutions of 1:1000 for the MIGA2/FAM73B (E3D7E) Rabbit mAb (#75375) against endogenous protein . This antibody has demonstrated reactivity to both human and mouse FAM73B, detecting bands at approximately 70 and 78 kDa . For quantitative mRNA expression analysis, real-time PCR (qPCR) using the ΔΔ CT method provides reliable results, though researchers should consider the individual efficiency corrected calculation method for more accurate quantification . According to comparative studies, the individual efficiency corrected calculation method yields estimates of relative gene amounts closer to true values than the standard 2^(-ΔΔCT) method when analyzing FAM73B expression . When designing qPCR experiments, it is advisable to include appropriate housekeeping genes such as GAPDH as reference controls and to prepare standard dilution series (1:10, 1:100, 1:1000) to validate assay performance, as demonstrated in previous FAM73B expression studies . Researchers should also be aware that PCR efficiencies for FAM73B have been estimated to range from 1.73 to 1.88, which contradicts the uniform efficiency assumption made by the standard 2^(-ΔΔCT) method .

How can researchers effectively manipulate FAM73B expression for functional studies?

Researchers seeking to manipulate FAM73B expression for functional studies should consider several complementary approaches tailored to their specific experimental systems. Gene knockout strategies through CRISPR-Cas9 technology provide a definitive method for studying the loss-of-function effects of FAM73B, as demonstrated in studies where Fam73b ablation revealed its role in mitochondrial dynamics and immune response . For transient manipulation, RNA interference using siRNA or shRNA targeting FAM73B can effectively reduce expression levels without permanent genetic modification. Overexpression studies can be performed through transfection of FAM73B expression plasmids, with subsequent sorting of transfected cells by fluorescence-activated cell sorting (FACS) to enrich for the transfected population . When designing such experiments, researchers should include appropriate controls such as empty vectors or non-targeting sequences. For cell culture-based studies of FAM73B, it's important to consider that 24-48 hours post-transfection is typically optimal for observing phenotypic effects, as indicated by protocols where cells were sorted 24 hours after transfection and used for experiments 24 hours later . Researchers should also consider tissue-specific conditional knockout models for in vivo studies, particularly when investigating FAM73B's role in specific cell types such as macrophages or dendritic cells.

What are the key experimental considerations when studying FAM73B's role in mitochondrial dynamics?

When investigating FAM73B's role in mitochondrial dynamics, researchers must implement specialized approaches to visualize, quantify, and functionally assess mitochondrial morphology changes. Mitochondrial morphology analysis requires high-resolution imaging techniques such as confocal microscopy or super-resolution microscopy, combined with specific mitochondrial staining methods or fluorescently-tagged mitochondrial proteins . Researchers should establish clear criteria for classifying mitochondrial morphology (e.g., fragmented, intermediate, or elongated) and ensure blinded quantification to avoid bias. To understand FAM73B's interactions with other mitochondrial dynamics proteins, co-immunoprecipitation experiments or proximity ligation assays can be employed to detect protein-protein interactions with fusion mediators (like MFN1/2) or fission factors (such as DRP1) . Functional assessments should include measurements of mitochondrial membrane potential, reactive oxygen species production, and ATP synthesis to correlate morphological changes with functional outcomes . When studying stimulus-induced changes in mitochondrial dynamics, such as TLR-mediated transitions from fusion to fission, time-course experiments are essential to capture the temporal sequence of events . Additionally, researchers should consider the metabolic state of the cells being studied, as nutrient availability and cellular stress can significantly influence mitochondrial dynamics independently of FAM73B manipulation.

How does FAM73B interact with the Parkin-mediated mitochondrial quality control system?

FAM73B exerts significant influence on the Parkin-mediated mitochondrial quality control pathway through its regulation of mitochondrial morphology and subsequent effects on Parkin recruitment . Research has revealed that mitochondrial morphology changes associated with FAM73B function directly affect both Parkin expression levels and its recruitment to mitochondria . When studying this interaction, researchers should employ co-localization analyses using fluorescently tagged Parkin and mitochondrial markers in both wild-type and FAM73B-deficient cells to quantify differences in Parkin recruitment patterns. Biochemical approaches, including subcellular fractionation followed by Western blotting, can provide quantitative data on the distribution of Parkin between cytosolic and mitochondrial compartments under different experimental conditions . The downstream effects on the CHIP-IRF1 axis should be assessed through protein stability assays, as Parkin controls the stability of this pathway through proteolytic mechanisms . Time-course experiments following mitochondrial stress induction are particularly valuable for capturing the dynamic nature of these interactions. Researchers investigating this pathway should also consider the potential effects of mitochondrial depolarization agents like CCCP (carbonyl cyanide m-chlorophenyl hydrazone) to discriminate between basal and stress-induced Parkin recruitment patterns in relation to FAM73B status . These experimental approaches will help elucidate how FAM73B-mediated mitochondrial dynamics influence mitochondrial quality control and cellular homeostasis.

What methodological approaches are best for investigating FAM73B's role in anti-tumor immunity?

Investigating FAM73B's role in anti-tumor immunity requires integrated experimental approaches spanning from molecular analyses to in vivo tumor models. Researchers should consider both syngeneic and xenograft tumor models using FAM73B-deficient mice or adoptive transfer of FAM73B-manipulated immune cells to assess effects on tumor growth and immune infiltration . Flow cytometric analysis of tumor-associated macrophages (TAMs) isolated from these models should evaluate polarization states, cytokine production (particularly IL-12), and functional characteristics . Ex vivo co-culture systems pairing TAMs with T cells can provide valuable insights into how FAM73B-mediated changes in macrophage function influence T cell activation and anti-tumor responses . At the molecular level, chromatin immunoprecipitation (ChIP) assays can help determine how FAM73B-dependent pathways affect the binding of transcription factors like IRF1 to cytokine promoters . Researchers should implement cytokine profiling through multiplex assays or ELISA to comprehensively characterize the inflammatory milieu resulting from FAM73B manipulation. When analyzing the Parkin-CHIP-IRF1 axis downstream of FAM73B, protein degradation assays using proteasome inhibitors can help establish the mechanistic link between mitochondrial dynamics and immune activation . Finally, translational relevance can be explored through correlation analyses between FAM73B expression in human tumor samples and markers of immune activation or patient outcomes, potentially identifying FAM73B as a prognostic biomarker or therapeutic target.

How should researchers interpret conflicting data when analyzing FAM73B expression using different methodologies?

When confronted with conflicting data regarding FAM73B expression from different methodological approaches, researchers should implement a systematic analytical framework to identify the sources of discrepancy and determine the most reliable results. First, critical evaluation of primer and antibody specificity is essential, as inconsistencies often stem from detection of different FAM73B isoforms or cross-reactivity with related proteins . Researchers should verify antibody specificity through appropriate controls, including FAM73B-knockout samples and pre-absorption tests. When comparing gene expression data from qPCR and protein quantification, researchers must consider that discrepancies might reflect post-transcriptional regulation rather than methodological errors . A comparative analysis of the individual efficiency corrected calculation method versus the 2^(-ΔΔCT) method for qPCR data has revealed significant variations in estimated expression ratios for FAM73B, with true ratios of 1:0.1:0.01:0.001 yielding estimated ratios of 1:0.44:0.038:0.0013 with the 2^(-ΔΔCT) method and 1:0.36:0.025:0.0017 with the efficiency corrected method . This demonstrates how methodological choices can significantly impact quantification outcomes. To resolve such conflicts, researchers should triangulate results using multiple independent techniques (e.g., Western blotting, immunofluorescence, and mass spectrometry for protein analysis; qPCR, RNA-seq, and Northern blotting for transcript analysis). Additionally, evaluation of sample preparation methods, normalization strategies, and statistical approaches used in each methodology can help identify procedural variables contributing to discrepancies.

How can researchers accurately assess the functional relationship between FAM73B and immune response pathways?

To accurately assess the functional relationship between FAM73B and immune response pathways, researchers must implement a multi-level experimental approach that addresses both direct mechanistic connections and broader functional outcomes. At the cellular level, comparing cytokine production profiles between wild-type and FAM73B-deficient immune cells following stimulation with various TLR agonists provides foundational insights into pathway-specific effects . This should include time-course analysis of cytokine expression at both mRNA and protein levels, particularly focusing on IL-12 production which has been specifically linked to FAM73B-mediated mitochondrial dynamics . To establish causality rather than mere correlation, researchers should perform rescue experiments reintroducing wild-type FAM73B or specific mutants into FAM73B-deficient cells to determine which domains or functions are essential for immune response regulation. Biochemical approaches such as immunoprecipitation followed by mass spectrometry can identify FAM73B-interacting proteins within immune signaling pathways, while phosphoproteomic analysis before and after immune stimulation can reveal FAM73B-dependent signaling events . Chromatin immunoprecipitation sequencing (ChIP-seq) for relevant transcription factors like IRF1 in wild-type versus FAM73B-deficient cells can map the genome-wide impact on transcriptional regulation . For in vivo relevance, challenge models using pathogens or inflammatory stimuli in FAM73B-deficient and control animals will demonstrate physiological significance. Additionally, single-cell RNA sequencing of immune populations from these models can reveal cell type-specific effects and potential heterogeneity in FAM73B-dependent immune responses that might be masked in bulk analyses.

What considerations are important when using recombinant FAM73B protein in experimental systems?

When incorporating recombinant FAM73B protein into experimental systems, researchers must address several critical considerations to ensure experimental validity and reproducibility. Source and quality control of recombinant FAM73B represent primary concerns, with commercially available options like the MIGA2/FAM73B (E3D7E) Rabbit mAb (#75375) offering superior lot-to-lot consistency, continuous supply, and animal-free manufacturing . Researchers should verify protein purity through SDS-PAGE and functional integrity through appropriate activity assays before experimental use. The correct folding and post-translational modifications of recombinant FAM73B are crucial considerations, as improper protein conformation may lead to artifactual results that don't reflect the native protein's function . For cell-based experiments, optimization of protein delivery methods is essential, as FAM73B is normally an integral membrane protein and may require specialized delivery vehicles or permeabilization techniques to reach its target location. Concentration optimization through dose-response experiments will help identify physiologically relevant working concentrations while avoiding potential toxicity or off-target effects at excessive concentrations. When studying FAM73B's role in mitochondrial dynamics, researchers should confirm proper localization of the recombinant protein to mitochondrial membranes through subcellular fractionation or imaging techniques . Control experiments using denatured protein or irrelevant proteins of similar size should be included to confirm specificity of observed effects. For long-term studies, researchers must consider the stability of recombinant FAM73B under experimental conditions, potentially necessitating fresh preparation or specific storage requirements to maintain activity. Finally, researchers should be aware that recombinant proteins used for research are typically labeled "For Research Use Only" and have not been approved for diagnostic or therapeutic purposes, limiting their applications to non-clinical research contexts .

How might FAM73B be targeted for potential therapeutic applications in cancer immunotherapy?

FAM73B represents a promising therapeutic target for cancer immunotherapy based on its fundamental role in regulating mitochondrial dynamics and subsequent effects on anti-tumor immune responses . Strategic approaches for targeting FAM73B could include small molecule inhibitors designed to disrupt its mitochondrial fusion-promoting activity, thereby mimicking the enhanced anti-tumor immunity observed in FAM73B-deficient models . Such inhibitors would need to be carefully optimized to specifically target FAM73B while minimizing off-target effects on related mitochondrial proteins. Another approach involves targeting FAM73B expression through RNA interference technologies, potentially delivered via tumor-tropic nanoparticles to enhance delivery to the tumor microenvironment. The development of FAM73B-targeting strategies specifically for tumor-associated macrophages (TAMs) could reprogram these cells toward an anti-tumor phenotype characterized by increased IL-12 production and enhanced T cell activation . Combination therapy approaches pairing FAM73B inhibition with immune checkpoint blockade (anti-PD-1, anti-CTLA-4) warrant investigation, as the enhanced IL-12 production resulting from FAM73B inhibition could synergize with checkpoint inhibition to overcome immunosuppression in the tumor microenvironment . Before clinical translation, researchers must thoroughly evaluate potential systemic effects of FAM73B inhibition, as mitochondrial dynamics are essential for normal cellular function across multiple tissues. Patient stratification biomarkers based on FAM73B expression levels or mitochondrial morphology in tumor samples could help identify individuals most likely to benefit from FAM73B-targeted therapies . Finally, the development of meticulously controlled drug delivery systems that can restrict FAM73B targeting to specific immune cell populations would represent an important advance in maximizing therapeutic efficacy while minimizing potential adverse effects.

What is the relationship between FAM73B and metabolic reprogramming in immune and cancer cells?

The relationship between FAM73B and metabolic reprogramming represents a fascinating frontier in understanding how mitochondrial dynamics influence cellular energy metabolism in both immune and cancer cells. FAM73B's role in promoting mitochondrial fusion directly impacts the metabolic capacity of cells, as the balance between fusion and fission influences oxidative phosphorylation efficiency, substrate utilization, and metabolic flexibility . In immune cells, FAM73B-mediated mitochondrial dynamics appear to influence metabolic shifts associated with activation and polarization, particularly in macrophages where ablation of FAM73B promotes a pro-inflammatory phenotype characterized by enhanced IL-12 production . This suggests that FAM73B may serve as a metabolic checkpoint in immune cell activation, potentially through mechanisms involving alterations in TCA cycle flux, electron transport chain activity, or reactive oxygen species generation. Investigating these connections requires comprehensive metabolic profiling through techniques such as metabolomics, Seahorse extracellular flux analysis, and stable isotope tracing to map substrate utilization patterns in FAM73B-manipulated cells . In cancer cells, where metabolic reprogramming is a hallmark feature, FAM73B may influence the balance between glycolytic and oxidative metabolism, potentially affecting tumor cell proliferation, survival, and response to therapy. The interplay between FAM73B and key metabolic regulators such as AMP-activated protein kinase (AMPK), mammalian target of rapamycin (mTOR), or hypoxia-inducible factor-1α (HIF-1α) represents an important area for investigation . Understanding these metabolic connections could reveal new therapeutic opportunities for targeting cancer metabolism through modulation of mitochondrial dynamics via FAM73B.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.