Recombinant Human Protein FAM74A1/A2 (FAM74A1)

Shipped with Ice Packs
In Stock

Description

Production and Applications

The protein is produced in diverse systems to suit experimental requirements:

Expression SystemAdvantagesProduct Codes
E. coliHigh yield, cost-effectiveCSB-EP719318HU1, RFL13991HF
YeastProper folding for eukaryotic proteinsCSB-YP719318HU1
BaculovirusSuitable for complex proteinsCSB-BP719318HU1
Mammalian CellsNative post-translational modificationsCSB-MP719318HU1

Applications include:

  • Bioassays: Studying protein interactions or signaling pathways .

  • ELISA: Detection and quantification using biotinylated variants (e.g., AviTag-BirA technology) .

  • Structural Studies: X-ray crystallography or NMR due to His-tag compatibility .

Research Findings and Functional Insights

While FAM74A1/A2’s biological role remains poorly characterized, its recombinant form is critical for investigating:

  • Cell Signaling: Potential involvement in intracellular pathways, though specific mechanisms are unconfirmed .

  • Protein Interactions: Partners and binding motifs require further elucidation .

  • Therapeutic Potential: Limited data, but its expression in human tissues suggests roles in cellular homeostasis .

Comparative Analysis of Recombinant Forms

The choice of expression system impacts protein quality and utility:

SystemPurityTagsApplications
E. coli>90%His-tagCrystallization, binding assays
Yeast>85%NativeFunctional studies
Baculovirus>85%NativeComplex protein interactions
Mammalian>85%NativePost-translational modifications

Challenges and Future Directions

  • Functional Elucidation: Current research focuses on mapping interactions and pathways .

  • Optimization: Enhancing yield and stability in alternative systems (e.g., insect cells) .

  • Diagnostic Tools: Development of ELISA kits for biomarker studies .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FAM74A1; Protein FAM74A1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
FAM74A1
Target Protein Sequence
MWRELRGCPGGDVETAQRLSQRRRGKSSEAVPEKTWRAQRMSQRRRGESSEAVPEKTWKE LRNSETVPEKTWKQLRRCLQEDVERVQRLSLLLHLAVFLWIIIAINFSNSGVKSQSSTYL PSGKILK
Uniprot No.

Target Background

Database Links

HGNC: 32029

UniGene: Hs.553802

Protein Families
FAM74 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the basic structure of human FAM74A1 protein?

FAM74A1 is a 127 amino acid protein encoded by a gene located on human chromosome 9. It belongs to a family of related proteins including FAM74A1/A2, FAM74A3 (159 amino acids), and FAM74A4 (123 amino acids) . The protein's structure has not been fully characterized in crystallographic studies, but sequence analysis suggests it contains typical protein structural motifs. When designing experiments involving this protein, researchers should consider its relatively small size when selecting appropriate expression systems and purification methods.

What is currently known about the physiological function of FAM74A1?

While the precise function of FAM74A1 remains under investigation, it is encoded on chromosome 9, which is associated with several important biological processes including potential roles in gender determination and contains the largest interferon family gene cluster . Current research methodologies to elucidate its function include knockout studies, protein-protein interaction analyses, and expression profiling across different tissues. Researchers should design experiments that incorporate appropriate controls when investigating novel functions, including comparison with related family members (FAM74A3, FAM74A4) that may have overlapping or distinct roles.

How is FAM74A1 distributed across human tissues?

Expression profiling studies suggest FAM74A1 may have tissue-specific expression patterns. While comprehensive distribution data is still emerging, methodological approaches to investigate this include RNA-seq analysis across tissue types, immunohistochemistry with validated antibodies, and quantitative PCR. When investigating tissue distribution, researchers should validate findings using multiple methodologies to overcome limitations inherent in any single detection method.

What expression systems are optimal for producing functional recombinant FAM74A1?

Recombinant FAM74A1 can be expressed in multiple systems including E. coli, yeast, mammalian cells (293, 293T, NIH/3T3, COS-7, CHO), and insect cells (Sf 9, Sf 21, Sf High Five) . The choice depends on research objectives:

Expression SystemAdvantagesDisadvantagesRecommended Applications
E. coli (BL21(DE3), JM115, Rosetta-GAMI)High yield, cost-effective, rapidLimited post-translational modificationsStructural studies, antibody production
Yeast (SMD1168, GS115, X-33)Higher eukaryotic PTMs, moderate yieldMore complex than bacterial systemsFunctional studies requiring some PTMs
Mammalian cellsNative-like PTMs, proper foldingLower yield, higher cost, longer timelineFunctional assays, protein-protein interactions
Insect cellsHigh yield of complex proteins, most PTMsSpecialized equipment neededLarge-scale production of functional protein

The methodology should be selected based on the planned downstream applications, with special consideration for protein folding requirements and post-translational modifications essential for function.

What are the optimal fusion tag strategies for purifying FAM74A1?

Multiple fusion tags can be employed including His, FLAG, MBP, GST, trxA, Nus, Biotin, and GFP tags . The selection should be based on:

Fusion TagBenefitsLimitationsPurification Method
His TagSmall size, minimal interference, efficient IMAC purificationPotential metal ion interferenceNickel or cobalt affinity chromatography
FLAG TagHighly specific epitope, gentle elutionHigher cost, lower binding capacityImmunoaffinity chromatography
MBPEnhances solubility, single-step purificationLarge size (43 kDa)Amylose resin affinity
GSTImproves solubility, simple detectionLarge size (26 kDa), potential dimerizationGlutathione affinity

Researchers should consider whether tag removal is necessary for downstream applications, as some tags may interfere with protein function or crystallization. Protease cleavage sites can be incorporated between the tag and target protein for removal post-purification.

What are the critical quality control parameters for recombinant FAM74A1 preparations?

Quality assessment of purified FAM74A1 should include:

  • Purity analysis via SDS-PAGE and densitometry (target >90-95% for most applications)

  • Western blot confirmation of identity

  • Mass spectrometry validation

  • Endotoxin testing for preparations intended for cell-based assays (<0.1 EU/μg protein)

  • Functional validation through application-specific assays

For studies requiring highest purity, researchers should implement multi-step purification protocols combining affinity chromatography with size exclusion or ion exchange chromatography.

How can FAM74A1 be effectively used in protein-protein interaction studies?

When investigating FAM74A1 interactions, researchers should consider:

  • Methodological approaches:

    • Pull-down assays using tagged recombinant FAM74A1

    • Yeast two-hybrid screening

    • Co-immunoprecipitation followed by mass spectrometry

    • Proximity labeling methods (BioID, APEX)

    • Surface plasmon resonance for quantitative binding kinetics

  • Controls and validation:

    • Use both N- and C-terminally tagged versions to ensure tag position doesn't interfere with interactions

    • Include non-specific binding controls

    • Validate key interactions through multiple independent methods

    • Confirm biological relevance through co-localization studies

Given its location on chromosome 9 and potential association with neurological processes suggested in the literature, researchers should consider screening for interactions with proteins involved in related pathways .

What considerations are important when designing antibodies against FAM74A1?

Antibody development for FAM74A1 requires careful epitope selection. Researchers should:

  • Perform sequence analysis to identify unique epitopes not present in related family members (FAM74A3, FAM74A4)

  • Consider both linear and conformational epitopes

  • Validate antibody specificity using:

    • Recombinant protein controls

    • Western blotting against endogenous protein

    • Immunoprecipitation followed by mass spectrometry

    • Knockout/knockdown validation

    • Cross-reactivity testing against related family members

For monoclonal antibody development, a combination of epitopes may provide comprehensive coverage of detection needs across different experimental contexts.

How should researchers design knockdown/knockout studies to investigate FAM74A1 function?

When designing gene silencing experiments:

  • For siRNA/shRNA approaches:

    • Design multiple targeting sequences to minimize off-target effects

    • Commercial FAM74A1 shRNA plasmids are available (e.g., sc-92878-SH)

    • Include scrambled sequence controls

    • Validate knockdown efficiency by qPCR and Western blot

  • For CRISPR-Cas9 knockout:

    • Design guide RNAs targeting early exons

    • Screen for complete protein loss via Western blotting

    • Sequence verify the modification

    • Generate rescue cell lines expressing wild-type protein to confirm phenotype specificity

  • Phenotypic analysis should include:

    • Cell viability and proliferation assessments

    • Changes in gene expression profiles

    • Alterations in relevant signaling pathways

    • Potential compensation by related family members

Is there evidence linking FAM74A1 to neurological disorders?

While direct evidence specifically for FAM74A1 is limited in the search results, related research suggests potential neurological connections. The protein's encoding region on chromosome 9 is associated with several neurological conditions . Additionally, research on RNA methylation processes involving the wider FAM protein family suggests potential roles in synaptic function and local protein synthesis .

Methodological approaches to investigate potential neurological roles include:

  • Expression analysis in normal versus diseased brain tissue

  • Correlation studies with markers of neurodegeneration

  • Functional studies in neuronal cell models

  • Animal models with conditional knockouts in neuronal populations

Researchers should design studies that can distinguish between direct causative roles and secondary associations.

How might FAM74A1 relate to fusion gene phenomena observed in cancer research?

While FAM74A1 itself has not been directly identified in fusion events in the provided search results, the related protein FAM174A has been found in a fusion with WWC1 in early-onset colorectal cancer . This suggests that:

  • Researchers should investigate whether FAM74A1 might participate in similar fusion events

  • Methodological approaches could include:

    • Targeted RNA-seq of cancer samples

    • FISH analysis to detect chromosomal rearrangements

    • RT-PCR with primers designed to detect potential fusion transcripts

    • Functional characterization of any identified fusion proteins

When investigating potential fusion events, researchers should implement rigorous controls and validation steps to distinguish true fusion events from sequencing or alignment artifacts.

What is known about FAM74A1's potential role in chromosome 9-related disorders?

FAM74A1's location on chromosome 9 suggests potential involvement in disorders associated with this chromosome. Research approaches should include:

  • Genetic association studies in patient cohorts with chromosome 9-related disorders

  • Analysis of copy number variations affecting the FAM74A1 locus

  • Expression studies in relevant disease tissues

  • Functional studies to determine how alterations in FAM74A1 might contribute to disease mechanisms

Particular attention should be paid to disorders involving sex determination and development, as chromosome 9 has been implicated in these processes .

What are the major technical challenges in FAM74A1 research?

Researchers face several methodological challenges:

  • Protein solubility issues:

    • Optimize expression conditions (temperature, induction parameters)

    • Test multiple fusion partners (MBP, GST) to enhance solubility

    • Consider on-column refolding protocols

  • Specificity of detection tools:

    • Validate antibodies against recombinant protein and endogenous expression

    • Develop highly specific detection methods that distinguish between related family members

  • Functional characterization:

    • Establish relevant assay systems to measure activity

    • Identify physiological binding partners

    • Determine subcellular localization patterns

What are the most promising future research directions for FAM74A1?

Based on available information, promising research avenues include:

  • Comprehensive interactome mapping to identify functional networks

  • CRISPR screens to identify synthetic lethal interactions

  • Investigation of potential roles in RNA processing or regulation

  • Exploration of relationships with interferon signaling pathways, given chromosome 9's enrichment for interferon genes

  • Further investigation of potential connections to neurological function and protein synthesis at synapses

Researchers should consider collaborative approaches that combine structural biology, functional genomics, and disease-focused investigations to develop a comprehensive understanding of this protein.

How can contradictory findings about FAM74A1 function be reconciled methodologically?

When faced with conflicting data, researchers should:

  • Carefully evaluate methodological differences between studies:

    • Expression systems used (bacterial vs. mammalian)

    • Presence/absence and position of fusion tags

    • Cell types or tissue contexts examined

    • Assay conditions and readouts

  • Conduct controlled comparative studies:

    • Direct side-by-side comparisons under identical conditions

    • Inclusion of appropriate positive and negative controls

    • Blinded assessment of outcomes when possible

  • Consider biological explanations for discrepancies:

    • Context-dependent protein functions

    • Differential splicing or post-translational modifications

    • Interaction with tissue-specific binding partners

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.