Recombinant Human Protein FAM74A7 (FAM74A7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
FAM74A7; Protein FAM74A7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-159
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
FAM74A7
Target Protein Sequence
MWRELRGCPGGDVETVQRLSRRRRGKSSEAVPEKTWRAQRMSQTRESSEAVPEKTWREFR GCPGEDVERAQRLRDCPGEDMETAQRLSARRRAESSEAVPEKTWRELKGCPQEDVERVQR LSLLLHLAVFLWIIIAINFSNSGVKSQSSTYLPSGKILK
Uniprot No.

Target Background

Database Links

HGNC: 34037

Protein Families
FAM74 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Recombinant Human Protein FAM74A7 and how does it relate to viral research?

The search results suggest potential connections between FAM74A7 and viral research. Based on available information, FAM74A7 appears related to the A7(74) strain of Semliki Forest virus (SFV), which belongs to the Alphavirus genus . This strain is notable for being avirulent in adult mice while exhibiting different temperature-dependent cell tropism characteristics. Unlike virulent SFV strains, A7(74) shows limited central nervous system infection and primarily transduces glial cells rather than neurons at physiological temperatures .

What expression systems are typically used for producing functional recombinant human proteins similar to FAM74A7?

For recombinant proteins similar to FAM74A7, researchers typically use eukaryotic expression systems to ensure proper protein folding and post-translational modifications. Based on methodologies for similar proteins, chimeric constructs with Fc tags are commonly employed to enhance stability and purification efficiency, as demonstrated with the EphA7 Fc Chimera protein . These fusion proteins combine the target sequence with human IgG1 domains to create stable, functionally active recombinant proteins suitable for research applications .

How should recombinant proteins like FAM74A7 be stored to maintain optimal activity?

For optimal stability, recombinant proteins similar to FAM74A7 should be stored in a manual defrost freezer to avoid repeated freeze-thaw cycles which can significantly reduce activity . When obtained in lyophilized form, reconstitution should be performed using appropriate buffers (such as PBS) at recommended concentrations (typically 100 μg/mL) . After reconstitution, working aliquots should be prepared to minimize repeated thawing of stock solutions. The shipping conditions (ambient temperature) differ from long-term storage requirements, making immediate proper storage upon receipt essential for maintaining protein integrity .

How can copy number alterations analysis techniques be applied to understand FAM74A7's role in pathogenesis?

Copy number alteration (CNA) analysis can provide valuable insights into the potential role of genes like FAM74A7 in disease pathogenesis. Methodologically, this involves:

  • Utilizing platforms such as Affymetrix arrays to detect genomic alterations

  • Applying Hidden Markov Model (HMM) algorithms to identify regions with copy number changes

  • Implementing stringent criteria (e.g., requiring at least three consecutive SNPs per segment) to minimize type I errors

  • Validating results through quantitative PCR (qPCR) comparison between affected tissues and control samples

  • Analyzing log2ratio and B-allele frequency values to determine copy number state

This approach has successfully identified genes involved in medullary thyroid carcinoma pathogenesis and could similarly be applied to investigate FAM74A7's potential involvement in disease processes .

What role might temperature-sensitivity play in FAM74A7-related virus research?

Temperature sensitivity appears to be a critical factor in A7(74)-related virus research, which may have implications for FAM74A7 studies. Research demonstrates that at 31°C, viral recombinants like SFV(A774nsP)-GFP and VA7-EGFP show significantly higher transduction efficiency than at 37°C . More importantly, temperature affects cell tropism – at 37°C these constructs primarily transduce glial cells with minimal neuronal involvement, while at 31°C a more substantial proportion of neurons are transduced (33-94% depending on the experimental system) . This temperature-dependent behavior may be fundamental to understanding the avirulence of A7(74) in adult animals, as it appears unable to replicate effectively in mature neurons at physiological body temperature .

How do mutations in the nonstructural protein regions affect the virulence of A7(74)-related viruses?

Mutations in nonstructural protein regions have been identified as key determinants of neurovirulence in A7(74)-related viruses. Specifically:

  • The nonstructural protein 3 (nsP3) gene contains critical virulence determinants, including an opal termination codon and a 21-nucleotide in-frame deletion near the nsP4 junction

  • Replacement of the entire nsP3 gene with that from virulent strains (like SFV4) can reconstitute the virulent phenotype

  • Substitution of the opal codon with arginine significantly increases virulence

  • Amino acid mutations rather than the deleted residues appear primarily responsible for attenuating virulence

  • The attenuating determinants reside entirely within the nonstructural region of the genome

These findings demonstrate the complex molecular basis of virulence and provide potential insights into how specific genetic elements might influence FAM74A7-related research.

What control experiments should be included when evaluating binding interactions for recombinant proteins like FAM74A7?

When designing binding interaction experiments for recombinant proteins similar to FAM74A7, researchers should implement these critical controls:

  • Positive control interaction: For example, EphA7 is known to bind Ephrin-A4 at specific concentrations (biotinylated rhEphrin-A4 Fc Chimera produces 50% optimal binding at approximately 1.5-6 ng/mL when EphA7 is coated at 2 μg/mL)

  • Concentration gradient analysis: Testing multiple concentrations to establish dose-dependent binding curves and determine EC50 values

  • Carrier protein controls: When using carrier-free protein preparations, additional stability controls may be necessary as carrier proteins like BSA enhance stability and increase shelf-life

  • Temperature controls: Based on the temperature sensitivity observed with A7(74)-related constructs, binding experiments should be conducted at multiple temperatures (e.g., 31°C and 37°C)

  • Specificity controls: Including structurally similar but non-binding proteins to confirm binding specificity

How can researchers optimize recombinant protein expression systems for functional studies of proteins like FAM74A7?

Optimization of recombinant protein expression systems for functional studies requires careful consideration of several factors:

  • Expression construct design: For proteins like EphA7, constructs typically include specific domains of interest (e.g., Met1-Val555 for EphA7) fused to tags that facilitate purification and detection

  • Carrier protein considerations: Determine whether carrier proteins like BSA are appropriate for the intended application – carrier-free preparations are recommended for applications where BSA might interfere

  • Purification strategy: Implementing appropriate filtration methods (e.g., 0.2 μm filtered solutions) and buffer systems (commonly PBS) to maintain protein stability and function

  • Reconstitution protocols: Establishing standardized reconstitution procedures at optimal concentrations (typically 100 μg/mL) to ensure consistent preparation quality

  • Functional validation: Developing application-specific activity assays to confirm that the recombinant protein retains its expected biological function

What factors should be considered when designing experiments to investigate temperature-dependent effects on protein function?

When investigating temperature-dependent effects on protein function, researchers should consider:

  • Physiologically relevant temperature range: Include both standard physiological temperature (37°C) and lower temperatures (e.g., 31°C) to capture potential temperature-sensitive behaviors

  • Cell type specificity: Different cell types may respond differently to temperature changes – for example, A7(74)-related constructs show different neuronal vs. glial tropism at different temperatures

  • Incubation time optimization: Temperature may affect reaction kinetics, requiring adjustment of experimental timeframes

  • Experimental system selection: Consider both complex systems (tissue slices) and simplified systems (dissociated cells) as temperature effects may manifest differently in these contexts

  • Validation methods: Implement multiple validation approaches (e.g., immunochemical and electrophysiological analyses) to comprehensively characterize temperature-dependent effects

How should researchers analyze copy number variation data in studies potentially involving FAM74A7?

Analysis of copy number variation data involves a multi-step approach:

  • Algorithm selection: Use specialized algorithms like Hidden Markov Model (HMM) provided by tools such as PennCNV to identify regions of copy number alteration

  • Filtering criteria: Apply stringent filtering (e.g., regions spanning at least three consecutive SNPs) to minimize false positives

  • Software implementation:

    SoftwareInput ValuesAlgorithm
    PennCNVLog2 ratio and B-allele frequencyHidden Markov Model
    Genotyping Console 4.1Log2 ratio and allele differenceBirdseed V2 and Canary
  • Experimental validation: Validate computational findings through quantitative PCR comparing samples of interest to appropriate controls

  • Functional correlation: Correlate identified copy number alterations with phenotypic or functional data to establish biological significance

What approaches can help reconcile conflicting data regarding temperature-dependent function in viral proteins?

When confronting conflicting data regarding temperature-dependent function:

  • Strain comparison: Systematically compare different virus strains (e.g., avirulent A7(74) vs. virulent L10) to identify specific genetic determinants of temperature sensitivity

  • Chimeric construct analysis: Create and analyze recombinant viruses with exchanged genomic regions to localize temperature-sensitive elements

  • Protein processing analysis: Implement pulse-chase experiments to detect differences in polyprotein processing speed at different temperatures, which may explain functional differences

  • Site-directed mutagenesis: Target specific residues (e.g., position 534 at the P4 position of cleavage site between nsP1 and nsP2, or position 1052 at the S4 subsite of nsP2 protease) to confirm their roles in temperature-dependent effects

  • Cell-type specific analysis: Evaluate temperature effects across multiple cell types, as A7(74) demonstrates different cell tropism at different temperatures

How can researchers distinguish between direct effects and experimental artifacts when studying recombinant proteins?

To distinguish genuine effects from artifacts when studying recombinant proteins:

  • Carrier protein controls: Compare carrier-free preparations with those containing carrier proteins like BSA to identify potential carrier-mediated effects

  • Concentration-dependent analysis: Establish dose-response relationships to confirm biological relevance

  • Multiple expression systems: Validate findings using proteins generated in different expression systems

  • Native vs. recombinant comparison: When possible, compare recombinant protein behavior with that of the native protein

  • Domain-specific constructs: Use constructs containing different functional domains to map activity to specific protein regions

What are the optimal reconstitution methods for lyophilized recombinant proteins?

For optimal reconstitution of lyophilized recombinant proteins:

  • Buffer selection: Use the recommended buffer (typically PBS) that maintains protein stability and activity

  • Concentration standardization: Reconstitute at the recommended concentration (e.g., 100 μg/mL) to ensure optimal stability and activity

  • Sterile technique: Maintain sterile conditions during reconstitution to prevent microbial contamination

  • Gentle handling: Avoid vigorous agitation which can cause protein denaturation; instead, gently swirl or rotate to dissolve

  • Aliquoting strategy: Prepare single-use aliquots to avoid repeated freeze-thaw cycles, which significantly reduce protein activity

How can researchers effectively validate copy number alterations identified in genomic studies?

Effective validation of copy number alterations requires:

  • Sample selection: Use paired samples (e.g., tumor tissue and blood from the same individual) to control for individual genetic variation

  • Quantitative PCR setup: Design primers specific to the regions of interest and reference regions with stable copy numbers

  • Experimental validation protocol: Implement quantitative PCR to confirm predicted copy number changes, particularly for regions containing genes of interest

  • Threshold application: Establish clear criteria for validation – for example, confirming copy number gain in experimental samples compared to paired controls

  • Functional validation: For validated CNAs, perform additional experiments to determine the functional consequences of these alterations

What approaches help resolve issues related to temperature-sensitive protein expression and function?

To address temperature-sensitivity challenges:

  • Temperature gradient analysis: Test protein expression and function across a range of temperatures (e.g., 31°C and 37°C) to identify optimal conditions

  • Cell system selection: Choose appropriate experimental systems, as temperature effects may vary between different cell types and tissue preparations

  • Incubation time optimization: Adjust incubation times at different temperatures to account for temperature-dependent kinetics

  • Validation methods combination: Implement multiple validation approaches (e.g., immunochemical detection and functional assays) to comprehensively characterize temperature effects

  • Genetic modification strategy: Consider introducing specific mutations known to affect temperature sensitivity (e.g., nsP3 modifications or protease cleavage site alterations) to manipulate temperature-dependent behavior

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.