Recombinant Human Protein JTB (JTB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human JTB Protein

Recombinant Human JTB (Jumping Translocation Breakpoint) protein is a bioengineered version of the endogenous JTB protein, produced through bacterial or mammalian expression systems. Native JTB is a 146-amino-acid transmembrane protein (16.4 kDa) with roles in mitosis, apoptosis regulation, and mitochondrial function . Recombinant variants are truncated or tagged for structural and functional studies, often expressed in E. coli or HEK293 cells . These constructs enable researchers to study JTB’s mechanisms in cancer progression, where it is frequently dysregulated .

Functional Roles and Cellular Mechanisms

JTB participates in key cellular processes:

  • Mitosis Regulation: Component of the Chromosomal Passenger Complex (CPC), ensuring proper chromosome alignment and spindle assembly .

  • Apoptosis Modulation: Inhibits TGFB1-induced apoptosis and promotes survival in cancer cells . Overexpression induces mitochondrial swelling and membrane potential loss .

  • Cancer Progression: Overexpressed in breast, prostate, and liver cancers, driving epithelial-mesenchymal transition (EMT), proliferation, and invasion .

Cancer-Related Pathways and Dysregulation

Proteomics studies in MCF7 breast cancer cells reveal JTB’s interaction with pathways critical to tumorigenesis:

PathwayKey Proteins/Functions
Epithelial-Mesenchymal Transition (EMT)ACTN1, EZR, COL3A1 (cytoskeleton remodeling, ECM degradation)
Mitotic Spindle AssemblyFLNA, FLNB, HSP90A (microtubule stabilization, chromosome segregation)
Fatty Acid MetabolismFASN (lipid biosynthesis, energy reprogramming)
Estrogen SignalingFOXA1, ESR1 (luminal breast cancer subtype regulation)
Oxidative StressSOD1, CALM1 (redox imbalance, pro-survival signaling)

Dysregulated JTB disrupts proteostasis, mitochondrial organization, and interferon signaling, while upregulating anti-apoptotic proteins like BCL2 .

Research Applications and Proteomics Insights

Recombinant JTB is pivotal in:

  • Mechanistic Studies: Identifying JTB-interacting partners (e.g., ribosomal proteins RPS14, RPL6) and their roles in translation reprogramming .

  • Therapeutic Targeting: Mapping pathways (e.g., EMT, fatty acid metabolism) for intervention in metastatic cancers .

  • Biomarker Development: Validating JTB as a prognostic marker for breast cancer subtypes .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for the specific delivery time.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize development of the specified tag.
Synonyms
JTB; HSPC222; Protein JTB; Jumping translocation breakpoint protein; Prostate androgen-regulated protein; PAR protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
31-146
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
JTB
Target Protein Sequence
EAPVQEEKLSASTSNLPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALMEQRLFWKFEGAVVCVALIFACLVIIRQRQLDRKALEKVRKQIESI
Uniprot No.

Target Background

Function
JTB is essential for normal cytokinesis during mitosis. It plays a role in the regulation of cell proliferation. It may be a component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex plays crucial roles at the centromere in ensuring correct chromosome alignment and segregation. It is also required for chromatin-induced microtubule stabilization and spindle assembly. JTB increases AURKB activity and inhibits apoptosis induced by TGFB1. Overexpression of JTB induces mitochondrial swelling and reduces mitochondrial membrane potential.
Gene References Into Functions
  1. Downregulation of JTB expression increases the Bax/Bcl-2 ratio and Bax expression, ultimately inducing G2-M phase arrest and apoptosis of PC3 cells. PMID: 23297497
  2. Silencing of JTB results in increased phosphorylation of p65 in HepG2 cells. PMID: 22615844
  3. The JTB structure bears a distant resemblance to the midkine/pleiotrophin fold, particularly in the conservation of distinctive disulfide bridge patterns. PMID: 22079049
  4. Due to its involvement in the cell cycle and its overexpression in several human cancers, JTB could represent a promising target for therapeutic intervention. PMID: 21225229
  5. Among ten hepatocellular carcinoma cases with amplicon 1q21-q22, significant gene expression levels of JTB, SHC1, CCT3, and COPA were observed in the tumors compared to the paired adjacent non-malignant liver tissues. PMID: 12586295
  6. Overexpression of JTB conferred resistance to apoptosis induced by ultraviolet radiation PMID: 19487072

Show More

Hide All

Database Links

HGNC: 6201

OMIM: 604671

KEGG: hsa:10899

STRING: 9606.ENSP00000271843

UniGene: Hs.6396

Protein Families
JTB family
Subcellular Location
Membrane; Single-pass type I membrane protein. Mitochondrion. Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle. Note=Detected at the centrosome and along spindle fibers during prophase and metaphase. Detected at the midbody during telophase.
Tissue Specificity
Ubiquitous. Expressed in all normal human tissues studied but overexpressed or underexpressed in many of their malignant counterparts.

Q&A

What is the basic structure of human JTB protein?

Human JTB protein is a 146 amino acid polypeptide with a molecular weight of approximately 16.4 kDa. The protein consists of a 30-amino acid signal sequence that can be processed and removed, a 75-amino acid cysteine-rich extracellular domain, a 21-amino acid hydrophobic transmembrane domain, and a 20-amino acid intracellular/cytoplasmic domain. The three main domains together account for about 13.2 kDa of the total molecular mass . Recombinant versions typically include tags such as His-tags for purification purposes, as seen in the sequence: MGSSHHHHHH SSGLVPRGSH MGSEAPVQEE KLSASTSNLP CWLVEEFVVA EECSPCSNFR AKTTPECGPT GYVEKITCSS SKRNEFKSCR SALMEQRL .

Where is JTB protein typically localized in cells?

JTB exhibits dynamic localization within cells. It can be found in the cell membrane, mitochondria, and microtubule cytoskeleton . During mitosis, JTB demonstrates specific localization patterns, appearing in the centrosome, spindle, and cytoplasm at different stages of cell division . This dynamic localization suggests its involvement in multiple cellular processes, particularly those related to cell division and mitotic regulation.

What are the primary biological functions of JTB protein?

JTB protein is required for normal cytokinesis during mitosis and plays an important role in regulating cell proliferation . It may function as a component of the chromosomal passenger complex (CPC), which acts as a key regulator of mitosis with essential functions at the centromere in ensuring correct chromosome alignment and segregation . JTB increases AURKB (Aurora Kinase B) activity and is required for chromatin-induced microtubule stabilization and spindle assembly . Additionally, it inhibits apoptosis induced by TGFB1 (Transforming Growth Factor Beta 1) .

What expression systems are typically used for recombinant JTB production?

Recombinant Human JTB protein is commonly expressed in Escherichia coli bacterial expression systems . This system allows for high-yield production of the protein fragment (typically amino acids 31-105) with greater than 85% purity as determined by SDS-PAGE . For research applications, the recombinant protein is often produced with affinity tags such as poly-histidine (His) tags to facilitate purification and detection .

What buffer conditions are optimal for JTB protein stability?

Based on commercial recombinant JTB preparations, the protein exhibits stability in buffer systems containing 20mM Tris-HCl (pH 8.0), 0.15M NaCl, 10% glycerol, and 1mM DTT . The protein is typically maintained at a concentration of approximately 0.25 mg/ml in this buffer system . When designing experiments involving JTB protein, it is advisable to avoid significant deviations from these buffer conditions unless specific compatibility testing has been performed.

What techniques are effective for studying JTB protein interactions?

Immunoprecipitation (IP) followed by mass spectrometry is an effective approach for identifying JTB protein interaction partners . In research settings, epitope-tagged versions of JTB (using HA, His, or FLAG tags) can be expressed in relevant cell lines to facilitate pulldown experiments . For protein-protein interaction studies, transient and stable transfection of target cells (such as MCF7 breast cancer cells) with tagged JTB constructs, followed by extraction, purification, and analysis using techniques like nano-liquid chromatography tandem mass spectrometry (nanoLC-MS/MS) has proven effective .

How is JTB implicated in cancer development?

The human JTB gene is located on chromosome 1 at position q21, a region involved in unbalanced translocation in various types of cancer . JTB protein is ubiquitously present in normal cells but is found to be overexpressed in several cancer types, particularly prostate and breast cancer . Research indicates that JTB can function as either a tumor suppressor or an oncogene depending on the specific malignancy context . This dual functionality makes it an intriguing target for cancer research, as understanding its context-dependent behavior may provide insights into cancer development mechanisms.

What methodologies are used to study JTB's role in breast cancer?

Researchers investigating JTB's role in breast cancer typically employ transfection of breast cancer cell lines (such as MCF7) with sense orientation of hJTB cDNA in expression vectors containing epitope tags (HA, His, and FLAG) . Both transient and stable transfection approaches have been utilized, with protein expression confirmed via Western blotting . Proteome analysis using techniques such as SDS-PAGE separation followed by in-gel digestion and nanoLC-MS/MS has been instrumental in identifying dysregulated proteins in JTB-overexpressing cells . Gene Set Enrichment Analysis (GSEA) algorithms are then applied to investigate biological processes and pathways associated with JTB protein upregulation .

What pathways are affected by JTB overexpression in cancer cells?

Gene Set Enrichment Analysis in JTB-overexpressing breast cancer cells has identified four significantly enriched gene sets from upregulated pathways: mitotic spindle assembly, estrogen response late, epithelial-to-mesenchymal transition (EMT), and estrogen response early . Overexpression of JTB is significantly associated with increased expression of proteins related to cytoskeletal organization and biogenesis, mitotic spindle organization, extracellular matrix remodeling, cellular response to estrogen, proliferation, migration, metastasis, lipid biogenesis, endocrine therapy resistance, and antiapoptosis . Additional affected pathways include tumor microenvironment acidification, transmembrane transport, glycolytic flux, iron metabolism, oxidative stress, metabolic reprogramming, and cancer drug resistance .

How can proteomics approaches be optimized for JTB functional studies?

For advanced JTB functional studies using proteomics, researchers should consider a comparative proteome analysis approach. This methodology involves transfecting cells with JTB-expressing constructs alongside appropriate controls, followed by protein extraction, separation, and analysis . Specifically, proteins should be extracted from transfected cells, separated using SDS-PAGE, subjected to in-gel digestion, and analyzed using high-resolution mass spectrometry such as nano-Acquity UPLC coupled with QTOF Xevo G2 Mass Spectrometer . Data processing can be optimized using specialized software such as Mascot 2.4 server and Scaffold 4.1 software . To enhance the functional assessment, Gene Set Enrichment Analysis should be performed using standardized algorithms (such as those available at https://www.gsea-msigdb.org/) with appropriate parameters: Hallmark enrichment with 1000 permutations, maximum size of 500 to exclude larger sets, and minimum size of 3 to exclude smaller sets .

What are the considerations for designing JTB overexpression and knockdown experiments?

When designing JTB manipulation experiments, researchers should consider several critical factors. For overexpression studies, the sense orientation of hJTB cDNA should be cloned into expression vectors containing epitope tags (HA, His, FLAG) under a strong promoter such as CMV . For knockdown studies, shRNA plasmids targeting JTB have proven effective . Both transient and stable transfection approaches should be evaluated based on the specific research question, with transient systems offering quicker results but stable systems providing more consistent expression levels for long-term studies. Expression levels must be rigorously confirmed via Western blotting using appropriate antibodies . When assessing biological effects, researchers should examine multiple cellular processes including proliferation, mitotic spindle organization, apoptosis resistance, and mitochondrial function, as JTB has been implicated in all these processes .

How can JTB be evaluated as a potential biomarker for cancer?

To evaluate JTB as a cancer biomarker, researchers should employ a multi-dimensional approach. First, quantitative expression analysis should be performed across diverse cancer types and matched normal tissues using techniques such as qRT-PCR, Western blotting, and immunohistochemistry. Since JTB is ubiquitously present in normal cells but overexpressed in various cancer types including prostate and breast cancer , establishing definitive expression thresholds is critical. Second, correlation analyses between JTB expression levels and clinical parameters (stage, grade, survival) should be conducted using patient cohorts with comprehensive clinical data. Third, multivariate analyses incorporating JTB with established biomarkers should be performed to assess its independent prognostic value. Finally, functional studies examining the effects of JTB modulation on cancer-related phenotypes (as described in studies using MCF7 breast cancer cells ) are essential to establish biological relevance. The protein's association with pathways like mitotic spindle assembly, estrogen response, and epithelial-to-mesenchymal transition makes it particularly relevant for breast cancer biomarker development .

What are common challenges in purifying recombinant JTB protein?

Purification of recombinant JTB protein presents several challenges researchers should anticipate. First, while E. coli expression systems yield high protein quantities, they lack post-translational modifications that may be present in naturally occurring JTB . Second, the protein contains multiple cysteine residues in its extracellular domain , which can form incorrect disulfide bonds during recombinant expression, potentially affecting protein folding and function. To address these challenges, researchers should consider including reducing agents like DTT (1mM) in purification buffers , optimizing expression conditions (temperature, induction time), and employing affinity chromatography methods leveraging the His-tag commonly incorporated in recombinant constructs . Additionally, testing the biological activity of purified protein is recommended prior to use in cell culture experiments .

How can the biological activity of recombinant JTB be verified?

Verifying the biological activity of recombinant JTB requires multiple complementary approaches. First, structural integrity should be confirmed via techniques such as circular dichroism or limited proteolysis. Second, functional assays should target known JTB activities, including: (1) effects on cell division and cytokinesis in relevant cell lines; (2) modulation of AURKB activity through in vitro kinase assays; (3) assessment of mitochondrial membrane potential in cells treated with recombinant JTB, as overexpression has been shown to reduce mitochondrial membrane potential ; and (4) evaluation of effects on TGFB1-induced apoptosis pathways . For advanced validation, researchers could perform rescue experiments in JTB-knockdown cells to determine if the recombinant protein can restore normal cellular functions disrupted by endogenous JTB depletion.

What statistical approaches are recommended for analyzing JTB-related proteomics data?

For robust analysis of JTB-related proteomics data, a structured statistical approach is essential. As demonstrated in published research, data should be presented as mean ± S.E.M. with statistical comparisons made using paired Student's t-test where appropriate . P values <0.05 should be considered statistically significant . For pathway enrichment analyses, Gene Set Enrichment Analysis (GSEA) with appropriate thresholds is recommended, with a false discovery rate (FDR) of <0.25 (25%) considered statistically significant according to GSEA standards . When analyzing dysregulated proteins, both upregulated and downregulated proteins should be systematically categorized by biological function to provide a comprehensive understanding of JTB's impact on cellular processes. Multivariate analyses may also be applied to identify potential confounding factors and ensure the observed changes are specifically attributable to JTB manipulation.

How should contradictory findings about JTB's role as oncogene versus tumor suppressor be reconciled?

The apparent contradiction regarding JTB's role as either an oncogene or tumor suppressor across different malignancies requires careful analytical approaches for reconciliation. Researchers should consider: (1) Tissue-specific context - systematically comparing JTB's molecular interactions and downstream effectors across different tissue types using techniques like comparative proteomics and transcriptomics; (2) Genetic background - evaluating how the broader mutational landscape of different cancers might modify JTB's functionality; (3) Signaling pathway integration - mapping how JTB interfaces with established oncogenic and tumor-suppressive pathways in each cancer type; and (4) Protein isoforms or post-translational modifications - investigating whether different JTB variants predominate in different contexts. Additionally, dose-dependent effects should be considered, as the concentration of JTB may determine whether it promotes or suppresses cancer-related phenotypes, similar to other proteins with context-dependent functions in cancer biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.