Recombinant Human Protein lifeguard 2 (FAIM2)

Shipped with Ice Packs
In Stock

Description

Molecular Overview

Recombinant Human FAIM2 is produced as a full-length protein (1-316 amino acids) in wheat germ expression systems, validated for use in SDS-PAGE, ELISA, and Western blotting . Key features include:

PropertyDetail
Gene NameFAIM2 (HGNC:17067)
UniProt IDQ9BWQ8
Structural Domains7 transmembrane domains, LC3-interacting region (LIR) motif
ExpressionPredominantly neuronal; detected in Golgi, ER, plasma membrane
Post-Translational ModificationsJNK-mediated phosphorylation, ubiquitination

Biological Functions and Mechanisms

FAIM2 primarily inhibits Fas/CD95-mediated apoptosis through:

  • Fas Receptor Interaction: Direct binding to Fas upstream of FADD, blocking caspase-8 activation .

  • Stress Kinase Modulation: ERK/JNK pathways regulate FAIM2 stability. ERK inhibition reduces FAIM2 levels, increasing apoptosis susceptibility .

  • Proteasome Regulation: JNK phosphorylation inhibits proteasomal degradation, enhancing FAIM2 accumulation during stress .

  • Autophagy Regulation: Facilitates autophagosome-lysosome fusion via LC3 interaction, independent of apoptotic functions .

Table 1: FAIM2 in Experimental Models

Disease/ConditionModel SystemKey FindingsReferences
Retinal DetachmentFaim2 KO miceAccelerated photoreceptor apoptosis; FAIM2 binds p53/HSP90 under stress
Cardiac HypertrophyTAC-induced miceFAIM2 deficiency exacerbates hypertrophy via TAK1-JNK/p38 MAPK activation
Cerebral IschemiaMiddle cerebral artery occlusionLarger infarct volumes in Faim2 KO mice; lentiviral FAIM2 reduces damage
Non-Small Cell Lung CancerHARA-B4 metastatic cellsFAIM2 promotes EMT and Wnt/β-catenin signaling, enhancing bone metastasis
Parkinson’s DiseaseSH-SY5Y neuroblastoma cellsFAIM2 overexpression rescues autophagy flux deficits

Regulation and Interaction Networks

FAIM2 operates within a complex interactome:

  • Key Partners: Fas receptor, HSP90, p53, LC3 .

  • Transcriptional Effects: Suppresses pro-apoptotic genes (Fas, Ripk1) under physiological conditions .

  • Post-Translational Control:

    • Degradation: Ubiquitin-proteasome system (50% degradation in 24 hrs without stress) .

    • Stabilization: FAS-ligand or JNK inhibition blocks degradation .

Therapeutic Potential

FAIM2 modulation shows promise in multiple contexts:

  • Neuroprotection: Lentiviral FAIM2 delivery reduces ischemic brain injury by 40% .

  • Cardiovascular Disease: AAV9-FAIM2 gene therapy attenuates pathological hypertrophy in rodents .

  • Oncology: Dual roles observed:

    • Pro-Tumor: Enhances NSCLC metastasis via EMT .

    • Anti-Tumor: Acts as a suppressor in neuroblastoma .

Expression Systems and Applications

ParameterRecombinant FAIM2 (ab161504)
HostWheat germ
Purity>90% by SDS-PAGE
ApplicationsAntibody production, caspase-8 interaction studies
Commercial UseResearch-grade protein for in vitro apoptosis assays

Challenges and Future Directions

  • Dual Roles: FAIM2’s context-dependent effects (e.g., pro-survival vs. pro-metastatic) complicate therapeutic targeting .

  • Delivery Challenges: Achieving neuron-specific overexpression in vivo remains technically demanding .

  • Emerging Strategies: Small-molecule stabilizers of FAIM2-protein interactions (e.g., HSP90-FAIM2 complexes) are under exploration .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will fulfill your requests to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please communicate with us, and we will prioritize developing the specified tag.
Synonyms
FAIM2; KIAA0950; LFG; LFG2; NMP35; TMBIM2; Protein lifeguard 2; Fas apoptotic inhibitory molecule 2; Neural membrane protein 35; Transmembrane BAX inhibitor motif-containing protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-316
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
FAIM2
Target Protein Sequence
MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVP LHPSWAYVDPSSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVRKVYTILLIQLLVTLAV VALFTFCDPVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTVFTLSMA YLTGMLSSYYNTTSVLLCLGITALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLI LAILLPFQYVPWLHAVYAALGAGVFTLFLALDTQLLMGNRRHSLSPEEYIFGALNIYLDI IYIFTFFLQLFGTNRE
Uniprot No.

Target Background

Function
Lifeguard 2 (FAIM2) is an antiapoptotic protein that uniquely protects cells from Fas-induced apoptosis. It regulates Fas-mediated apoptosis in neurons by interfering with caspase-8 activation. FAIM2 may play a role in cerebellar development by influencing cerebellar size, internal granular layer (IGL) thickness, and Purkinje cell (PC) development.
Gene References Into Functions
  1. Research suggests that high levels of miR-3202 in T lymphocytes may protect epithelial cells by targeting FAIM2. MiR-3202 could be a potential biomarker for chronic obstructive pulmonary disease. PMID: 29208459
  2. Studies indicate that miR-193b is crucial for the competitive endogenous RNA role of SNHG7 in FAIM2-supported tumorigenesis of lung cancer. PMID: 29131440
  3. FAIM2 expression is significantly downregulated in human masticatory mucosa during wound healing. PMID: 28005267
  4. Research has demonstrated that lncRNA-SNHG7 promotes the proliferation, migration, and invasion of lung cancer cells while inhibiting apoptosis by enhancing FAIM2 expression, suggesting that lncRNA-SNHG7, as a key regulator of gene expression, could be a promising therapeutic target for lung cancer treatment. PMID: 27666964
  5. The interaction of TRIM21 and LFG was analyzed by co-immunoprecipitation. Western blot analyses, real-time PCR, apoptotic process activity, and flow cytometric analyses were conducted to examine changes in regulatory processes. PMID: 26398169
  6. Significant differences in the associations of FAIM2 promoter methylation with sedentary behavior and physical activity were observed between obese and lean children. PMID: 25922107
  7. Methylation levels of the FAIM2 promoter are significantly associated with obesity and are independently associated with dyslipidaemia and its components in Chinese children. PMID: 25696115
  8. Low KRT13 mRNA expression is associated with oral squamous cell carcinoma. PMID: 25735388
  9. Results indicate that the TMBIM family exhibits comparable functions in maintaining intracellular Ca(2) homeostasis across a wide range of tissues. PMID: 25764978
  10. Research shows that FAIM2 beta-isoform is strongly expressed in breast tumor tissues. Fas sensitivity was reduced in MCF10A breast cells expressing the FAIM2 beta-isoform. PMID: 25069766
  11. This study highlights the significance of two candidate genes, SH2B1 and FAIM2, in the risk of overweight/obesity. PMID: 24621099
  12. A polymorphism in FAIM2 is associated with a higher myocardial infarction risk in type-2 diabetes mellitus subjects. PMID: 24393375
  13. The rs7138803 variant of FAIM2 was found to have no effect on obesity in a Chinese Han population. PMID: 23924573
  14. Faim2 is physiologically expressed in the brain during bacterial meningitis. PMID: 24335530
  15. Analysis identified SNPs at three loci known to be associated with BMI with genome-wide confidence (P<5x10(-8); FTO, MC4R and FAIM2). PMID: 21935397
  16. LFG is required for proper development and survival of granular and Purkinje cells and LFG may play a role in cerebellar disorders. PMID: 21957071
  17. LFG is strongly expressed in breast cancer epithelial cells. Moreover, the overexpression of LFG correlated with tumor grade and reduced Fas sensitivity. PMID: 20336406
  18. Data show that SNPs in SEC16B and TMEM18 were significantly associated with obesity, and the SNPs in GNPDA2, BDNF, FAIM2 and MC4R were marginally associated with obesity in Japanese. PMID: 19851340
  19. Human keratinocytes were transfected with either Flip, Faim, or Lifeguard (LFG). Our results suggest that heterotopic expression of antiapoptotic proteins can induce resistance of keratinocytes to a major mechanism of rejection. PMID: 17912957
  20. The tmbim2 may participate in cell death regulation by interacting with proteins of the Bcl-2 family, promoting tumor metastasis. This is deduced from the evolutionary conservation of the membrane protein family containing multiple membrane spanning segments. PMID: 18440869

Show More

Hide All

Database Links

HGNC: 17067

OMIM: 604306

KEGG: hsa:23017

STRING: 9606.ENSP00000321951

UniGene: Hs.567424

Protein Families
BI1 family, LFG subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane raft. Cell junction, synapse, postsynaptic cell membrane.
Tissue Specificity
Highly expressed in breast carcinoma tissues. Enhanced expression correlates with the grade of the tumor (grade II/grade III) in primary breast tumors (at protein level). Widely expressed. Expressed at high levels in the brain especially in the hippocampu

Q&A

What is FAIM2 and what are its primary biological functions?

FAIM2 (Fas apoptotic inhibitory molecule 2), also known as Lifeguard 2 or NMP35 (neuronal membrane protein 35), is an evolutionary conserved, predominantly neuronally expressed 35.1 kDa membrane protein. It belongs to the transmembrane BAX inhibitor motif containing (TMBIM) family .

FAIM2's primary function is inhibiting Fas/CD95-mediated apoptosis through direct interaction with Fas/CD95 upstream of Fas-associated death domain-containing protein (FADD) . FAIM2 does not downregulate Fas or FADD expression, nor interfere with binding of Fas agonists. Instead, it acts as a membrane-bound inhibitor of the death receptor pathway .

Subcellular localization studies have shown that postsynaptic membranes and dendrites are the predilection sites of FAIM2, with its upregulation coinciding with terminal differentiation and synapse formation in the brain .

How is FAIM2 expression regulated in different tissue types?

FAIM2 expression varies significantly across tissue types:

  • Neuronal tissue: FAIM2 is predominantly expressed in neurons, with highest expression during postnatal development coinciding with terminal differentiation and synapse formation .

  • Cardiac tissue: FAIM2 expression is downregulated in phenylephrine-induced hypertrophic cardiomyocytes and pressure overload-induced hypertrophic hearts .

  • Cancer tissues: FAIM2 expression is down-regulated in most tumor types compared to normal tissues, with expression levels correlating with prognosis in several cancers .

  • Muscle tissue: In the context of facioscapulohumeral muscular dystrophy (FSHD), DUX4 expression leads to reduced cellular levels of FAIM2 through TRIM21-mediated degradation .

Expression regulation appears to be context-dependent, with tissue-specific and disease-state variations in expression patterns.

What experimental models are available for studying FAIM2 function?

Several experimental models have been developed to study FAIM2:

Model TypeDescriptionApplicationsReference
Faim2-deficient miceUbiquitous null mutationStudies of development and disease phenotypes
Cardiac-specific knockout miceConditional knockout in cardiac tissueCardiac hypertrophy studies
Lentiviral overexpression systemsFAIM2 overexpression with GFP-tagGain-of-function studies in cell lines
siRNA knockdownTransient FAIM2 knockdownLoss-of-function studies
Pharmacological modulatorsmiR-3202 inhibitors affecting FAIM2 levelsFAIM2 upregulation studies

These models have been used to investigate FAIM2's role in neurological disorders, cardiac disease, cancer, and muscular dystrophy .

What are the optimal methods for detecting and quantifying FAIM2 protein in experimental systems?

Several complementary techniques can be used for detecting and quantifying FAIM2:

  • Western Blotting: Primary antibodies against FAIM2 (e.g., anti-FAIM2, PH6298, Abmart) can be used for detection and semi-quantitative analysis . Sample preparation should include proper membrane protein extraction protocols.

  • Immunohistochemistry: For tissue localization studies, standard immunohistochemistry protocols using deparaffinized and hydrated tissues with antigen retrieval (10 mM sodium citrate, pH 6.0) have been effective. Following primary antibody incubation (anti-FAIM2), DAB staining and hematoxylin counterstaining are commonly employed .

  • Quantitative PCR: For mRNA level quantification, qPCR with FAIM2-specific primers allows transcript level assessment.

  • Flow Cytometry: For cell surface expression analysis, fluorescently labeled antibodies against FAIM2 can be used in conjunction with flow cytometry.

  • Immunoprecipitation: To study protein-protein interactions, co-immunoprecipitation with FAIM2 antibodies has been used successfully to demonstrate its interaction with Fas/CD95 .

Detection sensitivity can be optimized by using tissue-specific positive controls and validating antibody specificity through knockout/knockdown controls.

How can researchers effectively manipulate FAIM2 expression for functional studies?

Researchers can modulate FAIM2 expression through several approaches:

  • Stable overexpression:

    • FAIM2 overexpression plasmids with GFP-tag can be transfected with pMD2.G and psPAX2 into 293T cells to produce lentiviruses .

    • Target cells can be infected with these lentiviruses and selected with puromycin (2 μg/ml).

    • Verification of overexpression should be performed by Western blot.

  • Knockdown approaches:

    • siRNA or shRNA targeting FAIM2 for transient or stable knockdown respectively.

    • CRISPR-Cas9 technology for complete knockout in cell lines.

  • miRNA-based regulation:

    • miR-3202 targets FAIM2 and can be used to downregulate its expression .

    • miR-3202 inhibitors can upregulate FAIM2 expression.

  • Inducible expression systems:

    • Tet-on/Tet-off systems for temporal control of FAIM2 expression.

  • Conditional knockout models:

    • Tissue-specific Cre-loxP systems for in vivo studies, such as cardiac-specific FAIM2 knockout .

Each approach should include appropriate controls and verification of expression levels through Western blot or qPCR.

What functional assays are most informative for studying FAIM2's role in apoptosis and cell survival?

Several assays can effectively assess FAIM2's anti-apoptotic and cell survival functions:

  • Fas-induced apoptosis assay:

    • Cells with manipulated FAIM2 expression are treated with Fas-activating antibodies (like CH11) or FasL.

    • Apoptosis is measured using annexin V/PI staining and flow cytometry.

  • Cell viability assays:

    • MTT/CCK-8 assays for metabolic activity measurement.

    • Colony formation assays to assess long-term survival and proliferation .

    • EdU staining assay for DNA synthesis and proliferation assessment .

  • Oxygen-glucose deprivation (OGD) model:

    • For neuronal studies, primary neurons with modified FAIM2 expression are subjected to combined oxygen-glucose deprivation .

    • Cell death is assessed by measuring LDH release or using live/dead staining.

  • Caspase activation assays:

    • Measurement of caspase-3/7, -8, and -9 activities using fluorogenic substrates.

    • Western blotting for cleaved caspases and PARP.

  • Mitochondrial integrity assays:

    • Measurement of mitochondrial membrane potential using JC-1 or TMRE.

    • Cytochrome c release from mitochondria.

  • In vivo models:

    • MCAO (middle cerebral artery occlusion) model for stroke studies .

    • Pressure overload-induced cardiac hypertrophy in cardiac-specific FAIM2 knockout mice .

How does FAIM2 contribute to neurological disorders and neuroprotection?

FAIM2 plays a critical role in neurological disorders through several mechanisms:

  • Ischemic stroke:

    • FAIM2 deficiency increases susceptibility to combined oxygen-glucose deprivation in primary neurons .

    • In mouse models of transient cerebral ischemia, FAIM2-deficient mice show increased neuronal cell death in the acute phase .

    • FAIM2 acts as a neuroprotector by inhibiting Fas/CD95-mediated apoptosis in the context of ischemic injury.

  • Neurodegenerative diseases:

    • In Parkinson's disease models, FAIM2-deficient mice exhibit increased neuronal cell death .

    • FAIM2 appears to modulate the balance between death receptor-mediated apoptosis and alternative signaling pathways in neurons.

  • Bacterial meningitis:

    • FAIM2 deficiency leads to increased neuronal death in models of bacterial meningitis .

  • Regenerative processes:

    • Beyond its role in cell death inhibition, FAIM2 deficiency has been associated with increased regeneration, suggesting an involvement in regenerative processes .

    • Disease stage-dependent regulation of FAIM2 expression potentially enables the switch between apoptotic and alternative Fas/CD95 signaling.

FAIM2's neuroprotective role makes it a potential therapeutic target for neuroprotective strategies in various neurological disorders.

What is the current understanding of FAIM2's role in facioscapulohumeral muscular dystrophy (FSHD)?

FAIM2 has emerged as a key player in the pathophysiology of FSHD:

  • DUX4-mediated FAIM2 degradation:

    • Inappropriate expression of DUX4 (a transcription factor) leads to FSHD development.

    • DUX4 expression reduces cellular levels of FAIM2 through post-translational regulation .

    • The E3 ubiquitin ligase TRIM21, a DUX4 target gene, is responsible for FAIM2 degradation downstream of DUX4 .

  • Impact on myoblast viability:

    • Human myoblasts overexpressing FAIM2 show increased resistance to DUX4-induced cell death .

    • FAIM2 knockdown in wild-type cells results in increased apoptosis, highlighting its pro-survival role.

  • Role in myogenic differentiation:

    • FAIM2 is necessary for myogenic differentiation of wild-type cells .

    • FAIM2 knockdown results in failure to differentiate into myotubes.

    • Remarkably, FAIM2 overexpression rescues the myogenic differentiation defect caused by low-level expression of DUX4 .

  • Therapeutic implications:

    • The dual role of FAIM2 in cell viability and myogenic differentiation opens new avenues for therapeutic targeting in FSHD.

    • Stabilizing FAIM2 levels or inhibiting TRIM21-mediated degradation might represent potential treatment strategies.

This pathway represents a crucial link between DUX4 expression and the pathogenicity observed in FSHD, both in terms of cell viability and impaired myogenic differentiation.

How is FAIM2 implicated in cancer biology and what is its potential as a pan-cancer biomarker?

FAIM2's role in cancer is complex and context-dependent:

These findings suggest FAIM2 could serve as a potential pan-cancer biomarker for prognosis and immune infiltration, with particular relevance in glioma and neuroendocrine tumors.

What is the role of FAIM2 in cardiac pathophysiology, particularly in cardiac hypertrophy?

Recent research has uncovered an important role for FAIM2 in cardiac pathophysiology:

  • Expression patterns in cardiac hypertrophy:

    • FAIM2 expression is downregulated in phenylephrine-induced hypertrophic cardiomyocytes.

    • Similarly, FAIM2 levels are reduced in pressure overload-induced hypertrophic hearts .

  • Functional impact on hypertrophic response:

    • FAIM2 significantly attenuates phenylephrine-induced enlargement of primary neonatal rat cardiomyocytes.

    • Conversely, FAIM2 knockdown aggravates the hypertrophic response .

    • Faim2 gene knockout significantly exacerbates cardiac hypertrophy and heart fibrosis in vivo .

  • Molecular mechanism:

    • FAIM2 suppresses the progression of cardiac hypertrophy by interacting with the mitogen-activated protein kinase (MAPK) signaling pathway.

    • Specifically, FAIM2 exerts its inhibitory effect by suppressing TAK1-JNK1/2-p38 MAPK signaling cascades .

  • Therapeutic potential:

    • FAIM2 functions as a novel negative regulator of pathological cardiac hypertrophy.

    • This positions FAIM2 as a potential therapeutic target for developing strategies to mitigate pathological cardiac hypertrophy.

These findings reveal a previously unrecognized role for FAIM2 in cardiac pathophysiology, extending its known functions beyond neuronal protection and cancer biology.

What are the molecular mechanisms by which FAIM2 inhibits Fas-mediated apoptosis?

FAIM2 inhibits Fas-mediated apoptosis through several molecular mechanisms:

  • Direct interaction with Fas/CD95:

    • FAIM2 directly interacts with Fas/CD95 upstream of FADD (Fas-associated death domain-containing protein) .

    • This interaction occurs at the membrane level and does not affect Fas expression or ligand binding.

    • FAIM2 coimmunoprecipitates with Fas but not with FADD, confirming its action at the receptor level .

  • Prevention of DISC formation:

    • By interacting with Fas/CD95, FAIM2 likely prevents the formation of the death-inducing signaling complex (DISC).

    • This interference occurs prior to FADD recruitment and subsequent caspase-8 activation.

  • Subcellular localization:

    • FAIM2 is predominantly localized to postsynaptic membranes and dendrites in neurons .

    • This strategic localization allows it to regulate Fas signaling at specific subcellular compartments.

  • Context-dependent regulation:

    • FAIM2's inhibitory function appears to be context-dependent, with disease stage-specific regulation enabling switches between apoptotic and alternative Fas/CD95 signaling .

  • Regulation by miRNAs:

    • miR-3202 has been identified as a regulator of FAIM2 expression, providing an additional layer of control over its anti-apoptotic function .

Understanding these molecular mechanisms has implications for developing targeted approaches to modulate FAIM2 activity in various disease contexts.

How does FAIM2 interact with other cellular pathways beyond the Fas/CD95 system?

FAIM2's functions extend beyond Fas/CD95 inhibition to interact with multiple cellular pathways:

  • MAPK signaling pathway:

    • In cardiac cells, FAIM2 suppresses TAK1-JNK1/2-p38 MAPK signaling cascades .

    • This inhibition mitigates pathological cardiac hypertrophy, suggesting a broader role in cellular stress responses.

  • Ubiquitin-proteasome system:

    • FAIM2 is targeted for degradation by the E3 ubiquitin ligase TRIM21 .

    • This regulation links FAIM2 to the broader ubiquitin-proteasome system and cellular protein quality control mechanisms.

  • Immune signaling pathways:

    • FAIM2 expression correlates with immune cell infiltration in various cancers .

    • Positive correlation with CD8+ T cell infiltration but negative correlation with myeloid-derived suppressor cells (MDSCs) in most tumors .

    • These correlations suggest FAIM2 may influence immune signaling and tumor microenvironment composition.

  • Cell differentiation pathways:

    • FAIM2 is necessary for myogenic differentiation .

    • Its knockdown results in failure of myoblasts to differentiate into myotubes, indicating involvement in differentiation signaling pathways.

  • DNA damage and repair pathways:

    • FAIM2 expression correlates with mismatch repair (MMR) genes and DNA methylation-related genes in multiple cancer types .

    • This suggests potential cross-talk with DNA damage response and epigenetic regulation mechanisms.

These diverse interactions position FAIM2 as a multifunctional signaling molecule rather than a simple inhibitor of Fas-mediated apoptosis.

What is known about the structure-function relationship of FAIM2 and how does this inform therapeutic strategies?

The structure-function relationship of FAIM2 provides insights for therapeutic targeting:

  • Protein structure characteristics:

    • FAIM2 is a 35.1 kDa transmembrane protein belonging to the transmembrane BAX inhibitor motif containing (TMBIM) family .

    • The protein contains multiple transmembrane domains characteristic of the TMBIM family.

    • The specific domains responsible for Fas interaction have not been fully characterized.

  • Functional domains:

    • While specific functional domains are not well-characterized, FAIM2's ability to interact with Fas/CD95 likely involves extracellular or transmembrane regions.

    • The regions involved in TRIM21 recognition and degradation would be distinct targets for stabilizing FAIM2 levels.

  • Post-translational modifications:

    • FAIM2 is subject to ubiquitination by TRIM21, leading to its degradation .

    • Understanding these modification sites could inform strategies to stabilize FAIM2.

  • Therapeutic implications:

    • Protein stabilization: Inhibiting TRIM21-mediated degradation could maintain FAIM2 levels in conditions like FSHD .

    • Mimetic peptides: Developing peptides that mimic FAIM2's Fas-binding region could provide targeted anti-apoptotic effects.

    • Gene therapy: Overexpression of FAIM2 has shown protective effects in multiple disease models .

    • miRNA modulation: Inhibiting miR-3202 increases FAIM2 expression and could be therapeutically beneficial .

  • Context-specific targeting:

    • In cancer, approaches might vary based on tumor type, as FAIM2 can have both tumor-suppressive and oncogenic roles depending on context .

    • In neurological disorders, enhancing FAIM2 expression or activity could provide neuroprotection .

The multifunctional nature of FAIM2 necessitates careful consideration of disease context when designing therapeutic strategies targeting this protein.

What are the optimal protocols for producing and purifying recombinant FAIM2 protein for experimental use?

Producing high-quality recombinant FAIM2 requires attention to its transmembrane nature:

  • Expression Systems:

    • Mammalian expression systems (HEK293 or CHO cells) are preferred for proper folding and post-translational modifications of FAIM2.

    • Baculovirus-infected insect cells (Sf9 or Sf21) can also be used for higher yields while maintaining proper folding.

    • E. coli systems may be used for truncated versions lacking transmembrane domains.

  • Expression Constructs:

    • Include affinity tags (His, FLAG, or GST) for purification.

    • Consider using inducible promoters (tetracycline-responsive) for controlled expression.

    • Signal peptides may improve membrane insertion and folding.

  • Purification Protocol:

    • Membrane protein extraction: Use non-denaturing detergents (DDM, CHAPS, or Triton X-100) for initial solubilization.

    • Affinity chromatography: Utilize the affinity tag for initial purification (Ni-NTA for His-tagged proteins).

    • Size exclusion chromatography: Further purify and remove aggregates.

    • Detergent exchange: Consider exchanging harsh detergents for milder ones or lipid nanodiscs for functional studies.

  • Quality Control:

    • SDS-PAGE and Western blotting: Verify size and immunoreactivity.

    • Mass spectrometry: Confirm protein identity and purity.

    • Circular dichroism: Assess secondary structure integrity.

    • Functional assays: Verify Fas-binding capability through co-immunoprecipitation or surface plasmon resonance.

  • Storage Considerations:

    • Store in small aliquots at -80°C.

    • Include glycerol (10-15%) and appropriate detergent at concentrations above CMC.

    • Avoid repeated freeze-thaw cycles.

This approach should yield functional recombinant FAIM2 suitable for biochemical and structural studies.

How can researchers design experiments to resolve contradictory findings about FAIM2's role in different disease contexts?

Resolving contradictory findings about FAIM2 requires systematic experimental design:

  • Context-specific analyses:

    • Use identical experimental methods across different cell types/tissues to identify context-specific effects.

    • Carefully control for cell type, disease stage, and microenvironmental factors that might influence FAIM2 function.

    • Employ parallel in vitro and in vivo models to identify discrepancies due to system complexity.

  • Temporal dynamics investigation:

    • Implement time-course studies to capture dynamic regulation of FAIM2.

    • Disease stage-dependent regulation of FAIM2 might explain contradictory findings observed at different timepoints .

    • Use inducible systems for precisely timed manipulation of FAIM2 expression.

  • Pathway interaction mapping:

    • Perform comprehensive interactome analyses (Co-IP coupled with mass spectrometry) across different contexts.

    • Use systems biology approaches to map FAIM2 interactions in different disease states.

    • Conduct parallel pathway inhibition studies to identify context-specific signaling partners.

  • Isoform-specific analysis:

    • Verify whether contradictory findings might be explained by different FAIM2 isoforms or post-translational modifications.

    • Use isoform-specific antibodies or expression constructs.

  • Methodological standardization:

    • Directly compare findings using standardized reagents (antibodies, cell lines, recombinant proteins).

    • Perform collaborative cross-laboratory validation studies.

    • Use multiple complementary techniques to confirm key findings.

  • Negative control optimization:

    • Include proper controls such as FAIM2 knockout cells/tissues.

    • Use scrambled siRNAs and empty vectors in parallel with experimental manipulations.

This systematic approach can help reconcile contradictory findings and establish more unified understanding of FAIM2's context-dependent functions.

What are the most reliable animal models for studying FAIM2 function in disease contexts?

Several animal models have proven valuable for investigating FAIM2 function:

  • Global FAIM2 knockout mice:

    • Viable and fertile phenotype without overt deficiencies .

    • Useful for studying FAIM2's role in development and disease models.

    • Shows increased susceptibility to neuronal damage in stroke, bacterial meningitis, and Parkinson's disease models .

  • Conditional FAIM2 knockout models:

    • Cardiac-specific knockout: Valuable for studying cardiac hypertrophy .

    • Neuron-specific knockout: More precise for neurological disease studies.

    • Inducible knockout systems: Allow temporal control of FAIM2 deletion.

  • Disease-specific models with FAIM2 modulation:

    • MCAO (Middle Cerebral Artery Occlusion): Standard model for ischemic stroke studies .

    • Pressure overload models: For cardiac hypertrophy studies (transverse aortic constriction) .

    • MPTP models: For Parkinson's disease studies .

    • Bacterial meningitis models: Using Streptococcus pneumoniae infection .

  • Cancer xenograft models:

    • Human cancer cell lines with manipulated FAIM2 expression implanted in immunodeficient mice.

    • Particularly valuable for glioma and neuroendocrine tumor studies .

  • AAV-mediated gene delivery models:

    • Adeno-associated virus serotype 9 (AAV9)-FAIM2 for rescue experiments .

    • Allows tissue-specific FAIM2 overexpression in adult animals.

  • Humanized models:

    • Patient-derived xenografts with varying FAIM2 expression levels.

    • CRISPR-engineered human FAIM2 sequences in mice for translational studies.

Model TypeApplicationAdvantagesLimitationsReference
Global FAIM2 KOGeneral functionComprehensive assessmentPotential compensatory mechanisms
Cardiac-specific KOCardiac hypertrophyTissue-specific effectsLimited to cardiac pathologies
MCAO + FAIM2 KOStrokeWell-established disease modelAcute model only
AAV9-FAIM2Rescue studiesTherapeutic potential assessmentVariable expression
Cancer xenograftsTumor biologyHuman cell contextImmunodeficient background

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.