Recombinant Human Protein MAL2 (MAL2)

Shipped with Ice Packs
In Stock

Description

Introduction to MAL2

MAL2 (myelin and lymphocyte protein 2) is a 19-kDa membrane protein belonging to the MAL family, characterized by four transmembrane domains . It resides in lipid rafts and facilitates transcytosis—a process for shuttling proteins across polarized cells like hepatocytes . Recombinant MAL2 enables researchers to study its structural and functional properties in vitro and in vivo.

Key Features:

  • Gene Location: Chromosome 8q24

  • Protein Structure: Four transmembrane domains, cytoplasmic N-terminal containing a putative EVH1 recognition motif (FPAP)

  • Expression Systems: Recombinant MAL2 is typically expressed in mammalian cell lines (e.g., HepG2, Clone 9) for functional studies .

Role in Cellular Processes

MAL2 regulates two critical pathways:

  1. Transcytosis:

    • Mediates apical transport of proteins like CD59 and polymeric immunoglobulin receptor in hepatoma HepG2 cells .

    • Depletion blocks cargo delivery at perinuclear endosomes, confirming its role in vesicular trafficking .

  2. Actin Remodeling:

    • Induces filopodia-like protrusions by interacting with Ena/VASP proteins via its EVH1 motif .

    • Redistributes invadopodia proteins, suppressing matrix degradation in hepatoma cells .

Cancer Implications: Dual Roles

MAL2 exhibits context-dependent roles in oncology:

Cancer TypeMAL2 ExpressionFunctional OutcomeMechanismSources
Ovarian CancerUpregulatedPromotes proliferation, invasion, EMTBinds TPD52, MUC1 chaperones
Hepatocellular CarcinomaDownregulatedTumor suppressionInduces anti-oncogenic protrusions
Breast/CervicalUpregulatedPoor prognosisMutations (missense/synonymous)

Recombinant MAL2 Applications

  • Trafficking Studies: Used to rescue transcytosis defects in MAL2-depleted HepG2 cells .

  • Cancer Research: Overexpression in Clone 9 hepatoma cells inhibits migration and invasion .

  • Therapeutic Development: Potential target for modulating vesicular transport or actin dynamics in metastatic cancers .

Key Research Findings

  1. Transcytosis Machinery:

    • MAL2 colocalizes with endosomal cargo and requires lipid raft association for function .

    • Exogenous MAL2 restores apical transport in antisense-treated cells .

  2. Anti-Oncogenic Activity:

    • Recombinant MAL2 expression reduces Hep3B cell migration by 40% and invasion by 60% .

    • GTP-dependent interaction with rab17 enhances Golgi-to-protrusion protein trafficking .

  3. Pro-Metastatic Role:

    • In ovarian cancer, MAL2 upregulation correlates with poor survival (HR = 1.8, p < 0.05) .

    • Silencing MAL2 reduces HO8910 cell proliferation by 35% .

Challenges and Future Directions

  • Contradictory Roles: MAL2’s dual function (pro- vs. anti-tumorigenic) demands tissue-specific investigations.

  • Therapeutic Targeting: EVH1 motif or rab17-binding domains could be leveraged for drug design .

  • Transcriptional Regulation: Discrepancies between mRNA overexpression and protein depletion in cancers require mechanistic elucidation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request based on availability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MAL2; Protein MAL2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
MAL2
Target Protein Sequence
MSAGGASVPPPPNPAVSFPPPRVTLPAGPDILRTYSGAFVCLEILFGGLVWILVASSNVP LPLLQGWVMFVSVTAFFFSLLFLGMFLSGMVAQIDANWNFLDFAYHFTVFVFYFGAFLLE AAATSLHDLHCNTTITGQPLLSDNQYNINVAASIFAFMTTACYGCSLGLALRRWRP
Uniprot No.

Target Background

Function
MAL2 is a key component of the polarized transport machinery. It plays a crucial role in the indirect transcytotic pathway, facilitating the exit of transcytosing cargo from perinuclear endosomes. This process enables the cargo to reach the apical surface via a raft-dependent pathway.
Gene References Into Functions
  1. MAL2 upregulation was observed in papillary thyroid gland tissues and was significantly correlated with poor overall survival. PMID: 30021343
  2. Research suggests that MAL2 and TPD52 may serve as potential biomarkers for clinical prognosis and could be promising therapeutic targets for colorectal cancer. PMID: 28562687
  3. MAL2 and STK16 work together to sort secretory soluble cargo into the constitutive secretory pathway in hepatocytes. PMID: 25084525
  4. Findings demonstrate for the first time the interaction of PLP and MAL2 in oligodendrocytic cells, supporting the previously proposed transcytotic model of PLP transport. PMID: 21573057
  5. MAL2 overexpression was highest in serous carcinomas compared to other histological subtypes of ovarian cancer. PMID: 20846453
  6. Upon differentiation, murine oligodendrocyte precursor and human oligodendroglioma derived cell lines upregulate MAL2 expression and accumulate it in an intracellular compartment, exhibiting peri-centrosomal localization. PMID: 19683524
  7. Data indicates that MAL2 is essential for transcytosis in HepG2 cells. PMID: 12370246
  8. MAL2 protein mRNA species were detected in the thyroid, and immunohistochemical analysis of thyroid follicles revealed MAL2 distribution to the apical membrane. PMID: 14576188
  9. These results suggest that MAL2 protein genes are not ubiquitously expressed in leukemic bone marrow in children and that RNA sample parameters can significantly influence gene expression measurements. PMID: 16620967
  10. The MAL2 gene effectively differentiated between chromophobe renal cell carcinoma (RCC) and benign oncocytoma groups using quantitative reverse transcription-PCR on fresh tissue samples. Similar trends were observed on formalin-fixed tissues. PMID: 17145811
  11. MAL2 plays a role in regulating tumor-associated protein mucin expression and/or localization. PMID: 19175940

Show More

Hide All

Database Links

HGNC: 13634

OMIM: 609684

KEGG: hsa:114569

UniGene: Hs.201083

Protein Families
MAL family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein. Endomembrane system. Cytoplasm, perinuclear region. Note=Associated with lipid rafts. In polarized epithelial cells, restricted to the apical surface. In hepatocytes, as well as in polarized hepatoma Hep-G2 cells, found in the canalicular membrane, equivalent to the apical surface, beneath the canalicular actin cytoskeleton. In non-polarized Hep-G2 cells, distributed to the perinuclear region.
Tissue Specificity
Predominantly expressed in kidney, lung, and liver. Also found in thyroid gland, stomach and, at lower levels in testis and small intestine.

Q&A

What is MAL2 and how does it relate to the MAL protein family?

MAL2 is a 176-residue (Mr = 19,000) transmembrane protein with four putative transmembrane domains that shares approximately 36% identity with MAL at the amino acid level. It belongs to the MAL protein family, which consists of proteins with structural and biochemical similarities. While MAL functions in the direct apical transport pathway, MAL2 plays a critical role in the indirect transcytotic route of membrane trafficking . The significance of this distinction lies in understanding specialized membrane trafficking mechanisms in polarized cells.

What is the typical expression pattern of MAL2 in cell lines and tissues?

MAL2 mRNA is predominantly expressed in specific epithelial cell types. Research has demonstrated that MAL2 is expressed in hepatoma HepG2 cells and epithelial cell lines including MDCK and Caco-2, all of which utilize the transcytotic pathway to transport membrane proteins to the apical surface. Expression levels vary, with HepG2 cells showing greater dependence on this pathway than MDCK and Caco-2 cells. MAL2 is notably absent in many other human cell lines, suggesting tissue-specific functions. In human tissue sections, MAL2 is specifically detected at the bile canalicular membrane region of hepatocytes . This expression pattern correlates with its functional role in transcytotic transport systems.

How is MAL2 post-translationally modified?

In contrast to exogenous MAL2 expression in experimental systems like COS-7 cells, endogenous MAL2 in HepG2 and Caco-2 cells migrates as a mixture of glycosylated (Mr = 30-40,000) and unglycosylated species (Mr = 19,000). The glycosylation of MAL2 is sensitive to endoglycosidase H treatment, indicating utilization of the single consensus N-glycosylation site present in the MAL2 molecule. This post-translational modification may influence MAL2 functionality in its native cellular environment . Understanding these modifications is essential for producing biologically relevant recombinant MAL2 protein for research applications.

How is MAL2 distributed in polarized cells?

In polarized HepG2 cells, MAL2 displays a distinctive subcellular localization pattern. Confocal microscopy reveals that MAL2 is predominantly distributed beneath the actin belt surrounding the bile canaliculus. Specifically, MAL2 is found in the subapical compartment of polarized hepatocytes, where it colocalizes with molecules being transported via the transcytotic pathway. This distribution is consistent across horizontal (x,y) and vertical (x,z) confocal planes, demonstrating that while actin extends into the bile canalicular space via microvilli, MAL2 remains confined to the subcanalicular region . This precise localization is critical for its function in the transcytotic transport process.

What is the relationship between MAL2 and lipid rafts?

MAL2 selectively partitions into lipid raft fractions in HepG2 cells, similar to other GPI-anchored proteins like CD59. Biochemical fractionation experiments demonstrate that MAL2 is recovered in detergent-insoluble membrane fractions, confirming its association with lipid rafts. This raft association is maintained regardless of glycosylation status and is essential for MAL2's function in transcytotic transport . Researchers investigating MAL2 should consider this property when designing isolation and purification protocols to maintain functional integrity of the recombinant protein.

What is the primary function of MAL2 in polarized hepatocytes?

MAL2 serves as an essential component of the machinery for the indirect transcytotic route of protein transport to the apical membrane in polarized hepatocytes. Experimental evidence demonstrates that MAL2 is required specifically for the exit of transcytosing molecules from perinuclear endosomes to downstream apical endosomal compartments. MAL2 depletion results in the accumulation of cargo proteins in perinuclear endosomal structures that are accessible to transferrin, indicating a block in transport beyond this point . This function is distinct from MAL protein, which operates in the direct apical transport pathway from the Golgi apparatus.

How does MAL2 depletion affect transcytotic transport?

Depletion of endogenous MAL2 using antisense oligonucleotides drastically blocks the transcytotic transport of both exogenous polymeric immunoglobulin receptor (pIgR) and endogenous glycosylphosphatidylinositol-anchored protein CD59 to the apical membrane. Importantly, MAL2 depletion does not affect the initial internalization of these molecules from the sinusoidal (basolateral) membrane but causes their accumulation in perinuclear endosomal compartments. Normal transcytosis can be restored in MAL2-depleted cells by expressing exogenous MAL2 designed to resist the depletion treatment, confirming the specificity of MAL2's role in this process . This functional requirement highlights MAL2 as a potential target for manipulating transcytotic processes in research applications.

What approaches can be used to deplete endogenous MAL2 for functional studies?

For targeted depletion of endogenous MAL2, antisense oligonucleotide technology has proven effective. A 19-mer phosphorothioate oligonucleotide complementary to the sequence surrounding the AUG translation initiation site of human MAL2 mRNA can reduce endogenous MAL2 levels to 2-10% of normal expression. Control experiments should include oligonucleotides with the same composition but different sequences to verify specificity. The depletion effect can be assessed by both immunoblot and immunofluorescence analyses . For optimal results, researchers should optimize transfection conditions specific to their cell model and confirm depletion levels before proceeding with functional assays.

How can researchers express modified MAL2 constructs resistant to antisense depletion?

To create MAL2 constructs resistant to antisense depletion, researchers can modify the 5' untranslated region and the first nucleotides of the coding region through silent substitutions, deletions, or insertions that prevent pairing with the antisense oligonucleotide. These modifications should be designed to maintain the integrity of the MAL2 protein while altering the nucleotide sequence targeted by the antisense oligonucleotide. PCR amplification using 5' oligonucleotide primers containing the desired modifications and a 3' primer specific for the MAL2 coding sequence, followed by cloning into an appropriate expression vector, allows for the generation of modified MAL2 constructs . These constructs can then be stably expressed in cells to study MAL2 function under conditions where endogenous MAL2 is depleted.

What methods are effective for detecting MAL2 in experimental systems?

MAL2 can be detected using monoclonal antibodies generated against specific peptide sequences, such as the mAb 9D1 developed against an NH2-terminal peptide of human MAL2. Verification of antibody specificity should be performed using positive controls (cells transiently expressing tagged MAL2) and negative controls (untransfected cells). For detection of endogenous MAL2, immunoblotting can distinguish between glycosylated and unglycosylated forms of the protein. Immunofluorescence microscopy, particularly confocal microscopy, is valuable for assessing the subcellular distribution of MAL2 in polarized cells, using F-actin staining with fluorescent phalloidin to visualize the apical membrane domain . For quantitative analysis, researchers should consider the sensitivity limitations of these detection methods.

How can MAL2's role in transcytosis be experimentally tracked in real-time?

To track MAL2's role in transcytosis in real-time, researchers can implement live-cell imaging techniques using fluorescently tagged cargo molecules and MAL2 constructs. This approach requires transfecting cells with dual-labeled constructs: MAL2 fused to a fluorescent protein (e.g., GFP variants) and transcytotic cargo molecules tagged with spectrally distinct fluorophores. Time-lapse confocal microscopy can then be employed to visualize the colocalization and trafficking of these molecules through various endosomal compartments. Based on previous studies, researchers should focus on the perinuclear endosomal region where MAL2 depletion causes cargo accumulation . For optimal results, imaging conditions should be optimized to minimize photobleaching while maintaining sufficient temporal resolution to capture trafficking events.

What considerations are important when producing recombinant MAL2 for structural studies?

When producing recombinant MAL2 for structural studies, several critical factors must be addressed. First, the expression system should account for MAL2's transmembrane nature and potential post-translational modifications, particularly N-glycosylation. Bacterial expression systems may be unsuitable due to their inability to perform mammalian-type glycosylation, making insect or mammalian cell expression systems preferable. Second, researchers must consider MAL2's association with lipid rafts, which may necessitate specialized solubilization and purification protocols to maintain the protein in a native-like membrane environment. Third, for structural studies requiring non-glycosylated protein, site-directed mutagenesis of the N-glycosylation site may be necessary. Finally, the presence of four transmembrane domains presents challenges for structural determination, potentially requiring techniques optimized for membrane proteins such as lipid cubic phase crystallization or cryo-electron microscopy . Pilot studies to assess protein yield, purity, and structural integrity should precede large-scale production efforts.

How might MAL2 function differ between different polarized cell types?

MAL2 function may exhibit cell type-specific variations based on the relative importance of transcytotic pathways. In hepatocytes (represented by HepG2 cells), which rely predominantly on transcytosis for apical protein delivery, MAL2 plays an essential role in this process. In contrast, epithelial cells like MDCK, which utilize both direct and indirect pathways for apical targeting, may exhibit more complex or redundant mechanisms involving MAL2. The co-expression of both MAL and MAL2 in MDCK cells suggests potential interplay between these proteins in regulating polarized trafficking . To investigate these differences, comparative studies using cell type-specific depletion of MAL2 combined with quantitative cargo trafficking assays would be informative. Researchers should also consider the influence of cell-specific binding partners and post-translational modifications on MAL2 function across different polarized cell types.

What are common challenges when working with transmembrane proteins like MAL2?

Working with transmembrane proteins like MAL2 presents several challenges including poor solubility, potential misfolding, and difficulties in maintaining native conformation during purification. When expressing recombinant MAL2, researchers often encounter low expression levels or inclusion body formation. To address these issues, consider using mild detergents like CHAPS or dodecylmaltoside for extraction, and avoid harsh solubilization conditions that may disrupt lipid raft association. Additionally, MAL2's glycosylation heterogeneity may complicate analysis, requiring enzymatic deglycosylation or mutagenesis of glycosylation sites for homogeneous preparations . For functional studies, verify that recombinant MAL2 properly localizes to lipid rafts and the subapical compartment to ensure biological relevance.

How can researchers distinguish between direct effects of MAL2 depletion and secondary consequences?

Distinguishing direct effects of MAL2 depletion from secondary consequences requires carefully designed control experiments. First, implement rescue experiments using MAL2 constructs resistant to depletion strategies to confirm specificity, as demonstrated in previous research . Second, conduct time-course studies to identify the earliest phenotypic changes following MAL2 depletion, which are more likely to represent direct effects. Third, perform protein interaction studies to identify direct binding partners of MAL2, helping to distinguish between direct mechanistic roles and downstream effects. Finally, compare the effects of MAL2 depletion with those of other proteins involved in transcytosis to identify MAL2-specific versus general transcytotic pathway disruptions. This multi-faceted approach enables more accurate interpretation of experimental results when manipulating MAL2 expression.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.