Recombinant Human Protein NKG7 (NKG7)

Shipped with Ice Packs
In Stock

Description

Mechanism of Action

NKG7 modulates immune responses through distinct pathways:

Cytotoxic Granule Exocytosis

NKG7 facilitates lytic granule release in NK and CD8⁺ T cells, enabling target cell killing. Loss of NKG7 reduces CD107a surface translocation, impairing cytotoxicity .

Lysosomal Regulation of mTORC1

NKG7 inhibits mTORC1 activity by disrupting vacuolar ATPase (v-ATPase) assembly on lysosomes. This metabolic regulation enhances CD8⁺ T cell durability and memory formation .

Immune Synapse Efficiency

NKG7-deficient CD8⁺ T cells form prolonged synapses with tumor targets, leading to cytokine hypersecretion (e.g., TNF-α, IL-2). While slower in direct killing, these cells compensate via cytokine-mediated tumor cell death .

In Vitro Studies

ParameterNKG7⁺/⁺ T CellsNKG7⁻/⁻ T Cells
Cytolytic efficiencyHighReduced
Synapse durationShortened (~2 hours)Prolonged (~6 hours)
Cytokine secretionModerateElevated TNF-α, IL-2
Data from MC38-OVA tumor co-cultures .

In Vivo Applications

  • Cancer Models: NKG7 overexpression in CD8⁺ T cells increases tumor-infiltrating lymphocytes and survival in melanoma and bladder cancer models .

  • Infectious Disease: NKG7 deficiency impairs parasite control in visceral leishmaniasis and malaria by reducing IFN-γ and TNF production .

Clinical Correlations

  • Bladder Cancer: High NKG7 expression in tumor-infiltrating CD8⁺ T cells correlates with prolonged survival (median 18.9 vs. 2.65 years in low-NKG7 cohorts) .

  • Immunotherapy: NKG7 mRNA transfection enhances anti-PD-1/PD-L1 efficacy in non-responder T cells, improving melanoma cell killing by 40–60% .

Therapeutic Potential

  • Adoptive Cell Therapy: NKG7 mRNA-engineered CD8⁺ T cells show enhanced tumor clearance in preclinical models .

  • Biomarker Development: NKG7 expression predicts immunotherapy response and survival in TCGA cancer datasets .

  • Targeted Inhibition/Activation: Modulating NKG7 could balance cytotoxicity and inflammation in autoimmune diseases or chronic infections .

Future Directions

  • Mechanistic Studies: Clarify NKG7’s role in lysosomal fusion and granule maturation .

  • Clinical Trials: Evaluate recombinant NKG7 protein or mRNA in combination with checkpoint inhibitors .

  • Toxicity Profiling: Assess risks of cytokine storms due to NKG7-mediated hyperactivation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery time estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
NKG7; GIG1; Protein NKG7; G-CSF-induced gene 1 protein; GIG-1 protein; Granule membrane protein of 17 kDa; GMP-17; Natural killer cell protein 7; p15-TIA-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
NKG7
Target Protein Sequence
MELCRSLALLGGSLGLMFCLIALSTDFWFEAVGPTHSAHSGLWPTGHGDIISGYIHVTQT FSIMAVLWALVSVSFLVLSCFPSLFPPGHGPLVSTTAAFAAAISMVVAMAVYTSERWDQP PHPQIQTFFSWSFYLGWVSAILLLCTGALSLGAHCGGPRPGYETL
Uniprot No.

Target Background

Database Links

HGNC: 7830

OMIM: 606008

KEGG: hsa:4818

STRING: 9606.ENSP00000221978

UniGene: Hs.10306

Protein Families
PMP-22/EMP/MP20 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytolytic granule membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in activated T-cells, in kidney, liver, lung and pancreas. Not expressed in brain, heart, or skeletal muscle. Expressed at high levels in TCR gamma delta-expressing CTL clones, and in some TCR alpha beta-expressing CTL clones (both CD4+ and CD8+

Q&A

What is the molecular structure and cellular localization of NKG7?

NKG7 is a membrane protein associated with cytolytic granules in cytotoxic lymphocytes. Confocal immunofluorescence microscopy studies have demonstrated that NKG7 predominantly co-localizes with late endosomal markers Lamp-1 and Rab-7 (Costes Pearson's Correlation Coefficient > 0.5), but not with early endosome marker EEA1 or Granzyme B . Upon formation of an immune synapse, NKG7 translocates to the plasma membrane at the interface with target cells, suggesting its role in regulating granule exocytosis rather than functioning as a direct cytolytic protein . This translocation pattern was first described almost two decades ago but only recently has its functional significance been elucidated .

Which immune cell populations express NKG7 and how does expression change during immune activation?

NKG7 is predominantly expressed in cytotoxic lymphocytes, including:

  • Natural killer (NK) cells (highest expression)

  • Effector CD8+ T cells

  • Cytotoxic CD4+ T cells associated with viral infections

RNA sequencing analysis shows that within CD8+ T cell populations, NKG7 expression follows a pattern:

  • Highest in terminal effector cells

  • Moderate in effector memory cells

  • Lower in central memory and naïve CD8+ T cells

Temporal expression analysis reveals that following CD8+ T cell activation with anti-CD3/28 antibodies in vitro, NKG7 protein levels initially decrease slightly in the first 48 hours post-activation but then increase sharply at 72 hours and continue to rise over time in culture .

What are the mechanistic pathways through which NKG7 influences cytotoxic lymphocyte function?

NKG7 regulates cytotoxic lymphocyte function through several interconnected mechanisms:

  • Immune synapse regulation: NKG7-deficient CD8+ T cells form prolonged immune synapses with target cells (average 80 minutes compared to 40 minutes in wild-type cells), leading to inefficient serial killing .

  • Granule trafficking: While NKG7 does not affect the polarization of cytotoxic molecules like Granzyme B to the immune synapse, it appears to regulate the process of granule exocytosis, facilitating efficient delivery of cytotoxic payloads .

  • Cytokine modulation: Loss of NKG7 leads to hypersecretion of inflammatory cytokines (including IFN-γ, TNF-α, and IL-2) following immune synapse formation, suggesting it plays a role in balancing cytotoxicity and inflammation .

  • CD107a regulation: NKG7 function in NK and CD8+ T cells is linked with their ability to regulate the translocation of CD107a (LAMP-1) to the cell surface, a critical step in the cytotoxic process .

How does the absence of NKG7 affect T cell-mediated cytotoxicity in experimental models?

Experimental comparisons between NKG7-deficient (Nkg7-/-) and wild-type (Nkg7+/+) CD8+ T cells reveal several critical differences:

  • Killing efficiency: NKG7-deficient CD8+ T cells show reduced cytotoxicity against target cells in vitro, despite normal expression of effector molecules like Granzyme A and Granzyme B .

  • Synapse dynamics: Live-cell imaging demonstrates that NKG7-deficient CD8+ T cells take significantly longer to disengage from target cells after forming an immune synapse (approximately 2-fold longer duration), impairing their ability to engage in serial killing .

  • Cytokine production: RNA-sequencing of NKG7-deficient CD8+ T cells stimulated with tumor cells shows significant upregulation of inflammatory cytokine and chemokine genes compared to wild-type cells .

  • In vivo tumor control: Surprisingly, MC38-OVA tumors grew at an equal rate in Nkg7+/+ and Nkg7-/- mice, suggesting compensatory mechanisms may exist in vivo or that the role of NKG7 may be context-dependent .

How does NKG7 expression correlate with response to immune checkpoint inhibitors?

Single-cell RNA sequencing analysis of patient samples has revealed that:

  • Appropriate expression of NKG7 is a characteristic feature of cytotoxic CD8+ T cells within complete responders to anti-PD-1 therapy .

  • Reduced NKG7 expression is a common feature among non-responders to checkpoint blockade .

  • NKG7 expression in the largest and most expanded T-cell clones correlates with therapeutic efficacy .

  • Longitudinal analysis of paired patient samples (baseline vs. post-treatment) highlights differential NKG7 expression as a key feature distinguishing responders from non-responders .

These findings suggest NKG7 expression could serve as a potential biomarker for predicting response to immunotherapy.

What methodological approaches can be used to enhance NKG7 expression for improved anti-tumor immunity?

Several approaches have been investigated to modulate NKG7 expression:

  • mRNA transfection: NKG7 mRNA transfection improves tumor-cell killing by CD8+ T cells from non-responders to immunotherapy and increases their response to anti-PD-1 or anti-PD-L1 therapy in vitro .

  • Transcriptional regulation: The transcription factor ETS1 plays a role in regulating NKG7 expression, offering a potential indirect approach to modulate NKG7 levels .

  • Adoptive cell therapy optimization: NKG7 mRNA therapy has been shown to improve the antitumor activity of murine tumor antigen-specific CD8+ T cells in an in vivo model of adoptive cell therapy, suggesting this approach could enhance clinical outcomes .

  • Temporal modulation: Understanding the kinetics of NKG7 expression following T cell activation (decreased at 48 hours, increased after 72 hours) may inform optimal timing for therapeutic interventions .

What are the optimal protocols for studying NKG7 function in primary human T cells?

For investigating NKG7 function in primary human T cells, researchers should consider:

  • Isolation and activation: Use magnetic bead-based negative selection for CD8+ T cell isolation from peripheral blood mononuclear cells, followed by activation with anti-CD3/28 antibodies for at least 72 hours to achieve peak NKG7 expression .

  • Functional assays:

    • Cytotoxicity assays: Co-culture with target cells at various effector:target ratios (e.g., 10:1, 5:1, 2.5:1) for 4-6 hours

    • Degranulation assays: Measure CD107a surface expression following stimulation

    • Live cell imaging: Track immune synapse formation and duration using fluorescent membrane labeling

  • Molecular analysis:

    • Flow cytometry for protein expression

    • Confocal microscopy for subcellular localization

    • RNA-seq or qPCR for transcriptional analysis

  • Genetic manipulation:

    • mRNA transfection for overexpression studies

    • CRISPR/Cas9 for gene knockout

    • siRNA for transient knockdown

What technical challenges must be addressed when generating and validating recombinant NKG7 protein?

Key technical considerations include:

  • Expression systems: Mammalian expression systems (HEK293, CHO cells) are preferred over bacterial systems due to the need for proper protein folding and post-translational modifications.

  • Solubility considerations: As a membrane-associated protein, NKG7 may present solubility challenges. Consider using:

    • Detergent screening (non-ionic detergents like Triton X-100 or NP-40)

    • Fusion tags (SUMO, MBP, or Thioredoxin) to enhance solubility

    • Truncated constructs that eliminate transmembrane domains

  • Functional validation:

    • Binding assays to identify interaction partners

    • Cell-based functional restoration assays in NKG7-deficient cells

    • Structural characterization (circular dichroism, thermal shift assays)

  • Storage and stability:

    • Glycerol (10-20%) to prevent freeze-thaw damage

    • Addition of reducing agents if cysteine residues are present

    • Aliquoting to avoid repeated freeze-thaw cycles

How does NKG7 function differ across various pathological conditions?

NKG7 plays diverse roles in different disease contexts:

  • Cancer: Critical for cytotoxic T cell and NK cell-mediated control of cancer initiation, growth, and metastasis .

  • Parasitic infections: NKG7 expressed by CD4+ and CD8+ T cells plays key roles in promoting inflammation during visceral leishmaniasis and malaria .

  • Viral infections: Highly expressed in cytotoxic CD4+ T cells associated with viral infections, suggesting a role in antiviral immunity .

  • Autoimmune diseases: The role of NKG7 in balancing cytotoxicity and inflammation suggests potential involvement in autoimmune pathology, though this remains to be fully characterized .

What are the conflicting findings on NKG7 function in the literature and how can they be reconciled?

Several apparent contradictions exist in the literature:

  • Tumor control paradox: Despite reduced cytotoxicity of NKG7-deficient CD8+ T cells in vitro, MC38-OVA tumors grew at similar rates in Nkg7+/+ and Nkg7-/- mice . This suggests compensatory mechanisms may exist in vivo or that the role of NKG7 may depend on tumor immunogenicity.

  • Cytokine vs. cytotoxicity balance: NKG7 appears to simultaneously promote cytotoxicity while limiting cytokine production . This dual role may represent a regulatory mechanism to balance direct killing with inflammatory signaling.

  • Expression kinetics: The transient downregulation of NKG7 at 48 hours post-activation, followed by upregulation after 72 hours , suggests a complex regulatory pattern that may be tied to specific phases of T cell differentiation.

These contradictions can be reconciled through careful experimental design that:

  • Examines multiple tumor models with varying immunogenicity

  • Considers the temporal dynamics of immune responses

  • Separates direct cytotoxic effects from inflammatory mechanisms

  • Accounts for potential compensatory pathways in genetic knockout models

What are the molecular binding partners of NKG7 and how do they influence its function?

The precise molecular mechanisms through which NKG7 regulates immune function remain incompletely understood. Future research should focus on:

  • Protein interaction networks: Immunoprecipitation coupled with mass spectrometry to identify binding partners in different subcellular compartments.

  • Structural studies: Determination of NKG7's three-dimensional structure to identify functional domains and potential interaction surfaces.

  • Post-translational modifications: Investigation of how phosphorylation, glycosylation, or other modifications affect NKG7 localization and function.

  • Lipid raft association: Analysis of NKG7's potential association with membrane microdomains during immune synapse formation.

How can single-cell multi-omics approaches advance our understanding of NKG7 biology?

Integration of multiple single-cell technologies offers powerful opportunities:

  • scRNA-seq + TCR-seq: Link NKG7 expression patterns with T cell clonality and antigen specificity in tumor microenvironments.

  • scATAC-seq + scRNA-seq: Identify regulatory elements controlling NKG7 expression and map upstream transcription factor networks.

  • Spatial transcriptomics: Correlate NKG7 expression with spatial location in tissues to understand its role in immune cell positioning and function.

  • Proteomics + Transcriptomics: Investigate potential post-transcriptional regulation of NKG7 by comparing protein and mRNA levels.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.