Recombinant Human Protein odr-4 homolog (ODR4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us; we will prioritize its inclusion.
Synonyms
ODR4; C1orf27; TTG1; TTG1A; Protein odr-4 homolog; hODR-4; LAG1-interacting protein; Transactivated by transforming growth factor beta protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-454
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ODR4
Target Protein Sequence
MGRTYIVEETVGQYLSNINLQGKAFVSGLLIGQCSSQKDYVILATRTPPKEEQSENLKHP KAKLDNLDEEWATEHACQVSRMLPGGLLVLGVFIITTLELANDFQNALRRLMFAVEKSIN RKRLWNFTEEEVSERVTLHICASTKKIFCRTYDIHDPKSSARPADWKYQSGLSSSWLSLE CTVHINIHIPLSATSVSYTLEKNTKNGLTRWAKEIENGVYLINGQVKDEDCDLLEGQKKS SRGNTQATSHSFDVRVLTQLLLNSDHRSTATVQICSGSVNLKGAVKCRAYIHSSKPKVKD AVQAVKRDILNTVADRCEMLFEDLLLNEIPEKKDSEKEFHVLPYRVFVPLPGSTVMLCDY KFDDESAEEIRDHFMEMLDHTIQIEDLEIAEETNTACMSSSMNSQASLDNTDDEQPKQPI KTTMLLKIQQNIGVIAAFTVAVLAAGISFHYFSD
Uniprot No.

Target Background

Function
May play a role in the trafficking of a subset of G-protein coupled receptors.
Gene References Into Functions
  1. LMO2, TAL1, Ttg-1, and SIL enhance V(D)J recombination above baseline levels in cell culture; these proteins, along with Hox11 and SCL (which are nicked but not efficiently cleaved), are also cleaved by RAG proteins *in vitro*. PMID: 18187418
Database Links

HGNC: 24299

OMIM: 609335

KEGG: hsa:54953

STRING: 9606.ENSP00000287859

UniGene: Hs.371210

Protein Families
ODR-4 family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitously expressed.

Q&A

What is Human Protein ODR-4 Homolog (ODR4)?

Human Protein ODR-4 Homolog (ODR4) is a 454 amino acid protein belonging to the ODR-4 family that may play a crucial role in the trafficking of specific G-protein coupled receptors (GPCRs) . The protein is identified in molecular databases with UniProt Primary Accession Number Q5SWX8 and entry name ODR4_HUMAN, KEGG identifier hsa:54953, and String database identifier 9606.ENSP00000287859 . This protein forms part of an endoplasmic reticulum complex and appears to have specialized functions related to receptor trafficking and cellular signaling pathways .

What are the key structural characteristics of ODR4?

ODR4 contains structural domains that facilitate its function in protein trafficking mechanisms, particularly in the context of GPCRs. While complete structural characterization is still developing, research indicates it localizes to the endoplasmic reticulum membrane where it interacts with multiple protein partners . The protein's ability to form complexes with other proteins, such as ODR-8/UfSP2 (Ufm1-specific protease 2), suggests the presence of specific binding domains that mediate these protein-protein interactions . Researchers investigating ODR4 structure should consider both its membrane association properties and its interacting domains when designing experimental approaches.

How is ODR4 expression regulated in different tissue types?

Based on current research, ODR4 and its binding partner ODR-8/UfSP2 are expressed in the same set of chemosensory neurons . This co-expression pattern suggests coordinated regulation of these proteins in specialized sensory cell types. Researchers studying ODR4 expression should employ tissue-specific approaches and consider examining expression levels across diverse cell types to fully characterize its expression profile. Methodology for such analysis might include quantitative PCR, immunohistochemistry with specific antibodies, or in situ hybridization techniques to visualize expression patterns in different tissues.

What methods are available for detecting and quantifying ODR4 in experimental samples?

For quantitative detection of ODR4 in experimental samples, enzyme-linked immunosorbent assay (ELISA) represents a well-established approach. Commercial ODR4 ELISA kits offer high sensitivity (< 0.094 ng/ml) with a testing range of 0.156-10 ng/ml . These assays employ a sandwich-type detection method with colorimetric readout, enabling precise quantification of ODR4 in various sample types including tissue homogenates, cell lysates, and biological fluids . For qualitative detection, western blotting with specific anti-ODR4 antibodies provides information about protein size and relative abundance. Immunofluorescence microscopy can be utilized to visualize subcellular localization, particularly in relation to endoplasmic reticulum markers.

How should researchers design experimental controls when studying ODR4 function?

When designing experiments to investigate ODR4 function, appropriate controls are critical for data interpretation. A robust experimental design should include the following control elements:

Control TypeDescriptionApplication
Negative ControlSamples lacking ODR4 expression (knockout/knockdown)Establishes baseline in functional assays
Positive ControlSamples with verified ODR4 expressionConfirms detection methods are working properly
Vector ControlEmpty vector transfectionControls for effects of transfection procedure
Wild-type ControlNon-mutated ODR4 expressionComparison point for mutant variants
Technical ReplicatesMultiple measurements of same sampleAccounts for measurement variation
Biological ReplicatesIndependent biological samplesAccounts for biological variation

Additionally, when studying ODR4's role in GPCR trafficking, controls should include cells expressing GPCRs without ODR4 to establish baseline trafficking efficiency. This comprehensive control strategy ensures experimental results can be interpreted with confidence and specificity.

What are the critical considerations for sample preparation when analyzing ODR4?

Sample preparation represents a crucial step in successful ODR4 analysis. For optimal results, researchers should carefully control the following parameters:

  • Storage conditions: Samples should be maintained at 4°C for short-term storage following collection, with long-term storage at temperatures appropriate for the sample type .

  • Extraction methodology: For membrane-associated proteins like ODR4, detergent selection is critical for efficient solubilization while maintaining protein structure.

  • Protease inhibition: Include appropriate protease inhibitor cocktails to prevent protein degradation during sample processing.

  • Sample homogeneity: Ensure thorough homogenization of tissue samples to achieve consistent extraction.

  • Dilution optimization: Determine optimal dilutions empirically for each sample type and detection method .

  • Consistency: Standardize preparation protocols across all experimental and control samples to minimize technical variability.

These considerations help ensure reliable and reproducible results when analyzing ODR4 in experimental settings.

What proteins interact with ODR4 and what functional complexes does it form?

ODR4 participates in several key protein-protein interactions that inform its cellular functions. According to STRING database analysis, ODR4 interacts with multiple protein partners with varying confidence scores :

Interaction PartnerDescriptionInteraction Score
UFSP2Ufm1-specific protease 20.737
UFSP1Inactive Ufm1-specific protease 10.530
RTP2Receptor-transporting protein 20.528
RTP1Receptor-transporting protein 10.479
DDRGK1DDRGK domain-containing protein 10.477
FAM177A1Protein FAM177A10.467
TXNL1Thioredoxin-like protein 10.457
CCDC173Coiled-coil domain containing 1730.454

Of particular significance is the interaction between ODR4 and ODR-8/UfSP2 at the endoplasmic reticulum membrane, forming a functional complex that appears to be involved in GPCR trafficking . ODR4 also physically binds to ODR-10, suggesting a direct role in processing or transporting specific GPCRs . The interaction with receptor-transporting proteins (RTP1 and RTP2) is particularly noteworthy as these proteins specifically promote functional cell surface expression of olfactory receptors .

How does the ODR4-UfSP2 complex function in GPCR trafficking?

The ODR4-UfSP2 (ODR-8) complex forms at the endoplasmic reticulum membrane and appears to play a specialized role in G-protein coupled receptor trafficking . UfSP2 is a cysteine protease known for its ability to liberate the ubiquitin-like modifier Ufm1 from its pro-form and protein conjugates . The complex formation between ODR4 and UfSP2, coupled with ODR4's binding to ODR-10, suggests a mechanism whereby this complex facilitates proper processing, folding, or transport of specific GPCRs through the secretory pathway .

Methodologically, researchers investigating this complex should consider:

  • Co-immunoprecipitation assays to confirm complex formation

  • Subcellular fractionation to verify endoplasmic reticulum localization

  • Fluorescence microscopy with co-localization analysis

  • Functional assays measuring GPCR surface expression with and without the complex components

  • Site-directed mutagenesis to identify critical interaction domains

How do RTP proteins interact with ODR4 in olfactory receptor trafficking?

The interaction between ODR4 and receptor-transporting proteins (RTP1 and RTP2) suggests a potential role in olfactory receptor trafficking . RTPs specifically promote the functional cell surface expression of olfactory receptors but not other GPCRs . This selective role mirrors ODR4's predicted function in trafficking specific GPCRs, suggesting a potential cooperative mechanism.

To investigate this relationship, researchers should consider:

  • Coexpression studies examining whether ODR4 enhances RTP-mediated olfactory receptor trafficking

  • Competitive binding assays to determine if ODR4 and RTPs bind simultaneously or competitively to olfactory receptors

  • Trafficking assays using fluorescently-tagged olfactory receptors to visualize transportation in the presence or absence of ODR4 and RTPs

  • Domain mapping to identify regions of interaction between these proteins

How can researchers study ODR4's role in GPCR trafficking using contemporary molecular techniques?

Investigating ODR4's role in GPCR trafficking requires sophisticated molecular approaches. Researchers should consider implementing:

  • CRISPR-Cas9 genome editing to generate ODR4 knockout cell lines for loss-of-function studies

  • Fluorescence recovery after photobleaching (FRAP) to measure GPCR mobility in membrane compartments

  • Single-molecule tracking to visualize real-time movement of GPCRs in the presence/absence of ODR4

  • Proximity ligation assays to detect transient interactions between ODR4 and GPCRs in situ

  • Mass spectrometry-based interactomics to identify the complete set of GPCRs interacting with ODR4

  • Super-resolution microscopy to visualize subcellular localization with nanometer precision

  • Bimolecular fluorescence complementation to visualize protein interactions in living cells

These approaches provide complementary data that together can elucidate the precise mechanisms by which ODR4 influences GPCR trafficking.

What methodological approaches can address contradictions in ODR4 functional data?

When addressing contradictory findings regarding ODR4 function, researchers should implement a multi-faceted methodological approach:

  • Standardize experimental conditions across studies, particularly expression systems and cell types

  • Implement multiple, orthogonal assays to measure the same functional outcome

  • Consider tissue-specific and GPCR-specific effects that might explain apparent contradictions

  • Perform dose-response experiments to identify potential threshold effects

  • Examine post-translational modifications that might alter function in different experimental contexts

  • Utilize both in vitro and in vivo models to capture physiological complexity

  • Design rescue experiments where ODR4 is reintroduced into knockout systems to verify specificity

By systematically addressing variables that might contribute to contradictory results, researchers can develop a more cohesive understanding of ODR4 function.

How might high-throughput screening approaches identify novel GPCRs that depend on ODR4 for trafficking?

High-throughput screening offers powerful strategies to identify GPCRs dependent on ODR4 for proper trafficking:

  • CRISPR activation/inhibition screens: Apply ODR4 knockdown or overexpression across cell lines expressing different GPCRs, measuring surface expression changes

  • Flow cytometry-based screening: Analyze surface expression of fluorescently tagged GPCR libraries in ODR4-modified cells

  • Automated imaging: Implement high-content imaging to assess subcellular localization of GPCRs with and without ODR4

  • Split reporter assays: Design split luciferase or fluorescent protein complementation systems that report on ODR4-GPCR interactions

  • Proteomic profiling: Compare membrane proteomes between ODR4-expressing and ODR4-deficient cells to identify trafficking-dependent GPCRs

  • Functional response screening: Measure ligand-induced signaling of GPCR arrays with and without ODR4 to identify functional dependencies

These approaches enable systematic identification of ODR4-dependent GPCRs, potentially revealing new therapeutic targets or biological pathways.

How do variations in the ODR4 gene correlate with human sensory disorders?

Investigating potential associations between ODR4 variations and sensory disorders requires a methodical research approach:

  • Genetic association studies: Compare ODR4 gene variants between individuals with specific sensory disorders and matched controls

  • Functional characterization: Express identified variants in cellular models to assess trafficking efficiency of relevant GPCRs

  • Patient-derived cells: Analyze GPCR surface expression and signaling in cells from patients with ODR4 variants

  • Animal models: Generate animal models expressing human ODR4 variants to assess sensory function in vivo

  • Structure-function analysis: Correlate location of variants with protein domains to predict functional impact

This integrated approach can establish whether ODR4 variants contribute to human sensory disorders and elucidate underlying mechanisms.

How can researchers design experiments to validate ODR4 as a therapeutic target?

Validating ODR4 as a potential therapeutic target requires rigorous experimental design:

  • Target validation studies should include:

    • Genetic validation using CRISPR-Cas9 knockout or knockdown approaches

    • Pharmacological validation using tool compounds that modulate ODR4 function

    • Rescue experiments demonstrating restoration of function with ODR4 reintroduction

  • Experimental design table for target validation:

ApproachMethodologyControl GroupsReadouts
GeneticCRISPR knockoutWild-type cells, off-target controlGPCR surface expression, signaling efficiency
PharmacologicalTool compound treatmentVehicle control, inactive analogDose-response, specificity testing
RescueControlled reexpressionEmpty vector, mutant ODR4Restoration of trafficking function
Disease modelPatient-derived cellsHealthy donor cellsPhenotype normalization
  • Therapeutic rationale assessment:

    • Identify specific disorders where ODR4 modulation could provide benefit

    • Assess potential for selectivity in targeting specific GPCR pathways

    • Evaluate potential adverse effects by examining broader ODR4 functions

This structured approach provides the necessary validation framework for considering ODR4 as a therapeutic target.

What research methods can elucidate the relationship between ODR4 and the UFM1 pathway in disease contexts?

The relationship between ODR4 and the UFM1 pathway presents intriguing research opportunities in disease contexts. To investigate this relationship, researchers should:

  • Employ co-expression analysis in disease-relevant tissues to determine correlation between ODR4 and UFM1 pathway components

  • Investigate whether ODR4 itself undergoes ufmylation and how this modification affects its function

  • Assess whether disruption of the UFM1 pathway affects ODR4-dependent GPCR trafficking

  • Examine whether ODR4-UfSP2 complex formation is altered in disease states

  • Implement proximity-dependent biotin labeling to identify substrates that might be co-regulated by ODR4 and the UFM1 pathway

  • Analyze genetic datasets for co-occurrence of variants in ODR4 and UFM1 pathway genes in disease populations

  • Develop cellular stress models to determine how the ODR4-UFM1 relationship responds to pathological conditions

These methodological approaches can reveal how the ODR4-UFM1 relationship contributes to disease mechanisms and potentially identify novel therapeutic strategies.

What computational approaches can predict structure-function relationships for ODR4?

Advanced computational approaches offer valuable insights into ODR4 structure-function relationships:

  • Homology modeling: Generate structural models based on related proteins to predict ODR4's tertiary structure

  • Molecular dynamics simulations: Simulate ODR4 behavior in membrane environments to understand conformational changes

  • Protein-protein docking: Predict interaction interfaces between ODR4 and its binding partners

  • Machine learning approaches: Train algorithms on known chaperone-GPCR interactions to predict ODR4-specific interactions

  • Evolutionary analysis: Identify conserved residues across species to pinpoint functionally critical regions

  • Network analysis: Map ODR4 into broader protein interaction networks to predict functional relationships

  • Integrative modeling: Combine experimental data (crosslinking, SAXS, cryo-EM) with computational predictions to refine structural models

These computational methods generate testable hypotheses about ODR4 structure and function that can guide experimental design.

How can single-cell approaches advance understanding of ODR4 function in heterogeneous tissues?

Single-cell technologies offer unprecedented resolution for studying ODR4 in complex tissues:

  • Single-cell RNA sequencing to:

    • Identify cell populations expressing ODR4 and its interaction partners

    • Correlate ODR4 expression with specific GPCR expression patterns

    • Map ODR4 expression across developmental trajectories

  • Single-cell proteomics to:

    • Quantify ODR4 protein levels across cell populations

    • Identify cell-specific post-translational modifications

    • Correlate ODR4 abundance with GPCR surface expression

  • Spatial transcriptomics to:

    • Map ODR4 expression in tissue architectural context

    • Identify spatial relationships between ODR4-expressing cells and their neighbors

    • Correlate spatial expression patterns with functional outcomes

  • CRISPR perturbations at single-cell resolution to:

    • Assess cell-type specific responses to ODR4 disruption

    • Identify compensatory mechanisms in specific cell populations

    • Map genetic interaction networks across cell types

These approaches can reveal cell-type specific functions of ODR4 that may be obscured in bulk tissue analysis.

How does ODR4 integrate with cellular quality control mechanisms?

The potential role of ODR4 in cellular quality control represents an important research frontier:

  • Investigate ODR4 behavior under:

    • Endoplasmic reticulum stress conditions

    • Unfolded protein response activation

    • Proteotoxic stress

  • Examine ODR4 relationships with:

    • ER-associated degradation (ERAD) machinery

    • Autophagy pathways

    • Molecular chaperone networks

  • Assess ODR4 dynamics during:

    • Cell cycle progression

    • Cellular differentiation

    • Aging processes

  • Determine if ODR4:

    • Undergoes stress-induced post-translational modifications

    • Relocalizes under stress conditions

    • Shows altered binding partner preferences during stress

Understanding how ODR4 functions within broader cellular quality control systems may reveal new roles beyond GPCR trafficking and provide insights into stress response mechanisms relevant to disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.