Recombinant Human Protein PAPPAS (PAPPA-AS1)

Shipped with Ice Packs
In Stock

Description

Definition and Molecular Context

The PAPPA-AS1 lncRNA has been implicated in hypertrophic scar development by upregulating Toll-like receptor 4 (TLR4) , while the recombinant protein form remains understudied. Below is a synthesis of technical data and research findings related to the recombinant protein.

Research Applications and Functional Insights

While PAPPA-AS1 lncRNA has demonstrated biological activity , the recombinant protein’s function remains uncharacterized. Potential research directions include:

Hypertrophic Scar Pathways

The PAPPA-AS1 lncRNA interacts with TAF15 (a RNA-binding protein) to upregulate TLR4, promoting fibrotic responses in scar tissue . Recombinant protein studies could explore:

  • Protein-RNA interactions: Does the PAPPA-AS1 protein modulate lncRNA stability or TLR4 signaling?

  • Therapeutic targeting: Could neutralizing antibodies against PAPPA-AS1 protein mitigate scar formation?

Bone Marrow and Mesenchymal Stem Cells (MSCs)

PAPP-A (the primary PAPPA protein) regulates IGF signaling in bone marrow MSCs, influencing tissue homeostasis . PAPPA-AS1’s role in this context is unexplored but warrants investigation.

Functional Validation

Commercial recombinant PAPPA-AS1 proteins are marketed for SDS-PAGE, Western blotting, and ELISA . Their utility in functional assays (e.g., IGF-binding, protease activity) remains unvalidated.

Comparative Analysis of PAPPA-AS1 and PAPPA Proteins

To contextualize PAPPA-AS1, its relationship to the canonical PAPPA protein is critical:

FeaturePAPPA (Pappalysin-1) PAPPA-AS1 (Recombinant Protein)
FunctionMetalloprotease; cleaves IGFBP-4/5 to release IGFUnknown
Biological RolePregnancy, bone remodeling, IGF regulationHypertrophic scars (lncRNA)
ExpressionPlacenta, serum, bone marrowLncRNA: Tissue-specific; Protein: Synthetic
Key ApplicationsIGF signaling assays, pregnancy diagnosticsResearch tools (SDS-PAGE, Western blot)

Critical Considerations and Gaps

  1. Classification Ambiguity: PAPPA-AS1’s designation as a non-coding RNA conflicts with recombinant protein availability. Researchers must verify whether the protein is endogenous or synthetic.

  2. Limited Functional Data: No peer-reviewed studies validate the recombinant protein’s activity.

  3. Therapeutic Potential: While PAPPA-AS1 lncRNA shows promise in scar research, protein-targeted therapies require further exploration.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
PAPPA-AS1; DIPAS; PAPPAS; Protein PAPPAS; DIPLA1 antisense RNA 1; DIPLA1 antisense gene protein 1; DIPLA1-antisense expressed; PAPPAS antisense RNA 1; PAPPAS antisense gene protein 1; PAPPAS-antisense expressed
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
PAPPA-AS1
Target Protein Sequence
MRYGFVRKKHRGLFLTTVAALPIWNPISEFVKWYKSHKLSQHCIRICGHLCQKHLDMFLS VIGQRWPIDVFSSVFDHQVSAIGSDIIWWFLKLFLVSFFFFF
Uniprot No.

Target Background

Database Links

HGNC: 35152

OMIM: 610689

STRING: 9606.ENSP00000398729

UniGene: Hs.728832

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in placenta with lower expression in brain, kidney and testis.

Q&A

What is PAPPA-AS1 and what is its molecular characterization?

PAPPA-AS1 is a long non-coding RNA (lncRNA) that has been identified as differentially expressed in hypertrophic scar (HTS) tissues compared to normal skin tissues . Molecular characterization shows that PAPPA-AS1 is localized in both the nucleus and cytoplasm of cells, as determined through Fluorescence In Situ Hybridization (FISH) assays . The recombinant form of the protein contains approximately 102 amino acids and can be produced with specific tags for experimental purposes . The nucleotide sequence has been characterized and is available in databases, enabling targeted molecular approaches for its study .

What experimental models are most appropriate for studying PAPPA-AS1 function?

Hypertrophic scar fibroblast (HTsFb) cells serve as the primary in vitro model for studying PAPPA-AS1 function . These cells show significantly elevated expression of PAPPA-AS1 compared to normal fibroblasts, making them suitable for loss-of-function studies . For in vivo investigations, HTS tissue models have been successfully employed to examine the effects of PAPPA-AS1 modulation on scar formation and progression . When designing experiments, researchers should consider the following methodology:

  • Use short hairpin RNA (shRNA) technology for effective knockdown studies in both cellular and tissue models

  • Include appropriate controls to account for non-specific effects

  • Implement rescue experiments (e.g., with pcDNA3.1-TLR4 vectors) to validate specificity of observed phenotypes

  • Consider both in vitro and in vivo approaches for comprehensive functional characterization

What techniques provide reliable detection and quantification of PAPPA-AS1 expression?

Multiple complementary techniques have proven effective for detecting and quantifying PAPPA-AS1:

  • Bioinformatics analysis of transcriptome data can identify differential expression patterns across tissue types

  • FISH assays enable visualization of subcellular localization in intact cells

  • RNA pull-down and RNA immunoprecipitation (RIP) assays confirm interactions with protein partners like TAF15

  • Quantitative PCR methods allow precise measurement of expression levels across experimental conditions

How does PAPPA-AS1 regulate the TLR4/MyD88 signaling pathway in hypertrophic scar development?

PAPPA-AS1 functions as a critical regulator of the TLR4/MyD88 signaling pathway during hypertrophic scar development. The mechanism involves a molecular interaction cascade where PAPPA-AS1 upregulates TLR4 expression through binding with TAF15, an RNA-binding protein . This upregulation subsequently activates downstream signal transduction through MyD88, leading to enhanced TGF-β1 signaling and the expression of fibrosis markers including collagen I, collagen III, and α-SMA .

Experimental validation of this regulatory pathway has been demonstrated through knockdown studies, where suppression of PAPPA-AS1 expression leads to:

  • Decreased TLR4 and MyD88 expression

  • Reduced activation of the TGF-β1 pathway

  • Suppressed proliferation of HTsFb cells

  • Inhibited expression of fibrosis markers

The specificity of this regulation has been confirmed through rescue experiments, where co-transfection with pcDNA3.1-TLR4 vector significantly reverses the inhibitory effects observed with PAPPA-AS1 knockdown .

What is the molecular mechanism underlying the interaction between PAPPA-AS1 and TAF15?

The interaction between PAPPA-AS1 and TAF15 represents a critical molecular mechanism in the pathogenesis of hypertrophic scars. This interaction has been confirmed through RNA pull-down and RIP assays, demonstrating direct binding between this lncRNA and the RNA-binding protein . TAF15, in turn, interacts with the promoter region of TLR4, establishing a regulatory axis that controls TLR4 expression .

This PAPPA-AS1/TAF15/TLR4 axis creates a sophisticated regulatory framework wherein:

  • PAPPA-AS1 binds to TAF15

  • The PAPPA-AS1/TAF15 complex interacts with the TLR4 promoter

  • This interaction enhances TLR4 transcription

  • Elevated TLR4 activates downstream signaling pathways that promote fibrosis

Disruption of this molecular interaction through targeted knockdown of PAPPA-AS1 leads to reduced TLR4 expression and signaling, with consequent amelioration of the hypertrophic scar phenotype in experimental models .

What methodological approaches are most effective for studying PAPPA-AS1 knockdown in fibroblast models?

Successful PAPPA-AS1 knockdown in fibroblast models requires careful methodological considerations:

  • Vector design and delivery:

    • Short hairpin RNA (shRNA) technology has been effectively employed for PAPPA-AS1 knockdown

    • Lentiviral delivery systems have demonstrated efficient transduction in both in vitro and in vivo models

  • Experimental controls:

    • Include appropriate negative controls (scrambled shRNA sequences)

    • Implement positive controls targeting genes with well-characterized knockdown phenotypes

    • Consider dose-response studies to determine optimal shRNA concentrations

  • Validation of knockdown efficiency:

    • Quantify PAPPA-AS1 expression levels using RT-qPCR

    • Consider both short-term (24-48h) and long-term (>72h) knockdown effects

    • Assess nuclear and cytoplasmic fractions separately given PAPPA-AS1's dual localization

  • Functional assessment:

    • Measure expression of downstream targets (TLR4, MyD88, TGF-β1)

    • Evaluate fibroblast proliferation rates and migration capacity

    • Assess production of extracellular matrix components (collagens)

    • Perform rescue experiments to confirm specificity

How can researchers optimize experimental design when investigating PAPPA-AS1 interactions with other molecular partners?

When investigating PAPPA-AS1 interactions with molecular partners like TAF15 and TLR4, researchers should consider these methodological strategies:

  • Comprehensive interaction screening:

    • RNA pull-down followed by mass spectrometry to identify novel binding partners

    • RNA immunoprecipitation (RIP) to confirm specific interactions

    • Cross-linking immunoprecipitation (CLIP) for mapping precise binding sites

  • Functional validation:

    • Mutational analysis of PAPPA-AS1 to identify critical interaction domains

    • Competition assays with synthetic RNA fragments to disrupt specific interactions

    • Co-expression studies to assess dose-dependent effects

  • Pathway analysis:

    • Evaluate effects on TLR4/MyD88 and TGF-β1 signaling pathways

    • Assess changes in downstream transcriptional targets

    • Monitor alterations in cellular phenotypes (proliferation, differentiation, ECM production)

  • In vivo validation:

    • Develop tissue-specific knockdown models

    • Implement rescue experiments with wild-type and mutant constructs

    • Evaluate temporal dynamics of molecular interactions during scar formation

What are the key differences between recombinant PAPPA-AS1 protein and native PAPPA-AS1 in functional studies?

Recombinant PAPPA-AS1 protein preparations differ from native PAPPA-AS1 in several important aspects that researchers should consider:

FeatureRecombinant PAPPA-AS1Native PAPPA-AS1
Production methodCell-free protein synthesis (CFPS) using Nicotiana tabacum lysates Endogenously expressed as lncRNA in cells
StructureProtein form with 102 amino acids Long non-coding RNA with specific secondary structure
Tags/modificationsCan include Strep Tag or other purification tags No artificial tags, may have natural modifications
Typical applicationsELISA, SDS-PAGE, Western Blotting Functional studies of gene regulation and signaling
LocalizationDepends on experimental deliveryBoth nuclear and cytoplasmic
Interaction partnersMay retain some binding capacity to partners like TAF15Confirmed interaction with TAF15 and TLR4 promoter

When designing experiments utilizing recombinant PAPPA-AS1, researchers should validate whether the recombinant form can replicate the functional properties of the native lncRNA, particularly regarding molecular interactions and signaling effects.

How should researchers approach contradictory data regarding PAPPA-AS1 expression in different experimental systems?

When encountering contradictory data regarding PAPPA-AS1 expression across different experimental systems, researchers should implement a systematic troubleshooting approach:

  • Methodological standardization:

    • Employ consistent RNA extraction protocols optimized for lncRNA preservation

    • Standardize detection methods (primers, probes, antibodies) across experiments

    • Implement rigorous normalization strategies using multiple reference genes

    • Consider absolute quantification methods alongside relative quantification

  • Biological considerations:

    • Evaluate cell type-specific expression patterns

    • Assess the impact of cell culture conditions (passage number, confluence, media composition)

    • Consider the influence of microenvironmental factors on PAPPA-AS1 expression

    • Examine potential expression of splice variants or isoforms

  • Technical validation:

    • Employ multiple detection methodologies (qRT-PCR, RNA-seq, in situ hybridization)

    • Include positive and negative control samples in all experiments

    • Assess subcellular fractionation to account for compartmentalized expression

    • Implement biological replicates with appropriate statistical analysis

  • Contextual interpretation:

    • Consider pathological context (normal vs. hypertrophic scar tissues)

    • Evaluate temporal dynamics of expression during disease progression

    • Assess potential regulatory factors that might influence expression patterns

    • Integrate findings with broader literature on lncRNA regulation

What are optimal purification strategies for recombinant PAPPA-AS1 protein to maintain functional integrity?

Based on available data, optimal purification strategies for recombinant PAPPA-AS1 protein should include:

  • Expression system selection:

    • The ALiCE® system based on Nicotiana tabacum lysates has been successfully employed

    • This system contains protein expression machinery capable of producing complex proteins with post-translational modifications

  • Affinity tag implementation:

    • Strep Tag conjugation has been utilized for PAPPA-AS1 purification

    • Tag selection should be based on protein complexity and downstream applications

    • Alternative tags may be necessary depending on specific experimental requirements

  • Purification protocol:

    • One-step affinity chromatography has proven effective

    • Optimized buffer conditions should be determined empirically to maintain protein solubility

    • Careful consideration of pH, salt concentration, and additives is crucial

  • Quality control measures:

    • SDS-PAGE analysis to confirm protein integrity and purity

    • Western blotting for specific detection

    • Activity assays to verify functional preservation

    • Mass spectrometry to confirm sequence integrity

  • Storage considerations:

    • Determine optimal buffer composition for long-term stability

    • Evaluate the impact of freeze-thaw cycles on protein activity

    • Consider addition of stabilizing agents if necessary

How can researchers effectively translate in vitro findings on PAPPA-AS1 function to in vivo models of pathological scarring?

Translating in vitro findings on PAPPA-AS1 function to in vivo models requires strategic experimental design:

  • Model selection:

    • Choose appropriate animal models that recapitulate key features of human hypertrophic scarring

    • Consider genetic backgrounds that may influence wound healing and scarring responses

    • Develop tissue-specific PAPPA-AS1 modulation approaches

  • Intervention strategies:

    • Lentiviral delivery of shRNA against PAPPA-AS1 has demonstrated efficacy in vivo

    • Consider timing of intervention (preventive vs. therapeutic approaches)

    • Evaluate local vs. systemic administration methods

    • Develop targeted delivery systems to enhance specificity

  • Outcome assessment:

    • Implement comprehensive histological analysis of scar tissues

    • Quantify expression of fibrosis markers (collagens, α-SMA)

    • Assess TLR4/MyD88 and TGF-β1 pathway activation

    • Evaluate functional and cosmetic outcomes of scarring

    • Consider long-term follow-up to assess scar maturation

  • Mechanistic validation:

    • Confirm PAPPA-AS1/TAF15/TLR4 axis function in vivo

    • Perform rescue experiments with TLR4 expression vectors

    • Evaluate potential compensatory mechanisms that may emerge in vivo

    • Consider the influence of inflammatory cells and immune responses not present in vitro

The in vivo experiments have already shown promising results, with lentiviral particles containing shRNA against PAPPA-AS1 demonstrating alleviation of pathological state and inhibition of fibrosis marker expression in HTS tissues .

What are the promising therapeutic targeting strategies for PAPPA-AS1 in pathological scarring conditions?

Given PAPPA-AS1's established role in hypertrophic scar development, several therapeutic targeting strategies show promise:

  • RNA interference approaches:

    • shRNA-mediated knockdown has already demonstrated efficacy in both in vitro and in vivo models

    • siRNA delivery systems could provide an alternative strategy with potentially different pharmacokinetics

    • Antisense oligonucleotides (ASOs) might offer enhanced stability and delivery advantages

  • CRISPR-Cas9 gene editing:

    • Targeted disruption of the PAPPA-AS1 gene could provide long-term therapeutic effects

    • Modification of regulatory elements controlling PAPPA-AS1 expression might offer more nuanced control

    • Base editing approaches could modify specific functional domains without complete knockout

  • Small molecule inhibitors:

    • Development of compounds that disrupt the PAPPA-AS1/TAF15 interaction

    • Molecules targeting the binding of this complex to the TLR4 promoter

    • Modulators of downstream signaling pathways activated by this regulatory axis

  • Combination approaches:

    • Simultaneous targeting of PAPPA-AS1 and TLR4 signaling

    • Combined RNA-based therapies with conventional anti-fibrotic agents

    • Sequential therapeutic approaches targeting different phases of scar formation

Each strategy requires careful evaluation for delivery efficiency, target specificity, duration of effect, and potential off-target consequences before clinical translation.

How might the function of PAPPA-AS1 relate to other wound healing disorders beyond hypertrophic scarring?

The molecular mechanisms through which PAPPA-AS1 influences hypertrophic scarring suggest potential roles in other wound healing disorders:

  • Keloid disorders:

    • Given the similarities between hypertrophic scars and keloids, PAPPA-AS1 may play a role in keloid formation

    • Differential regulation could contribute to the distinctive features of keloids compared to hypertrophic scars

    • The TLR4/MyD88 pathway influenced by PAPPA-AS1 has been implicated in keloid pathogenesis

  • Chronic non-healing wounds:

    • Dysregulation of TLR4 signaling is associated with impaired healing in diabetic wounds

    • PAPPA-AS1 might influence the inflammatory phase of wound healing through TLR4 modulation

    • Altered MyD88-dependent signaling affects antimicrobial responses critical in chronic wounds

  • Fibrotic disorders in other tissues:

    • The regulation of TGF-β1 signaling by PAPPA-AS1 suggests potential roles in liver, lung, or kidney fibrosis

    • Common molecular mechanisms of fibrosis across tissues implicate TLR4 and TGF-β pathways

    • PAPPA-AS1 might serve as a tissue-specific modulator of common fibrotic pathways

  • Surgical adhesion formation:

    • Post-surgical adhesions share molecular mechanisms with scarring

    • TGF-β1 signaling plays a central role in adhesion development

    • PAPPA-AS1 might influence the balance between normal healing and excessive fibrosis leading to adhesions

Comparative studies examining PAPPA-AS1 expression and function across these related conditions could provide valuable insights into common and distinct pathogenic mechanisms.

What are the key technical challenges in studying PAPPA-AS1 and how can they be overcome?

Researchers face several technical challenges when studying PAPPA-AS1, each requiring specific methodological solutions:

  • lncRNA detection sensitivity:

    • Challenge: Lower expression levels compared to protein-coding genes

    • Solution: Implement highly sensitive detection methods such as droplet digital PCR, employ targeted enrichment strategies before sequencing, and optimize RNA extraction protocols specifically for lncRNA preservation

  • Structural characterization:

    • Challenge: Complex secondary structures that affect function

    • Solution: Utilize techniques like selective 2'-hydroxyl acylation analyzed by primer extension (SHAPE), parallel analysis of RNA structure (PARS), or cryogenic electron microscopy for structural determination

  • Functional assessment:

    • Challenge: Multifaceted roles in different cellular compartments

    • Solution: Employ compartment-specific knockdown/overexpression approaches, develop domain-specific mutants to dissect function, and implement high-throughput screening to identify functional elements

  • Protein interactions:

    • Challenge: Transient or context-dependent binding with partners

    • Solution: Apply techniques such as CLIP-seq or RAP-MS to identify RNA-protein interactions, use proximity labeling methods to capture transient interactions, and implement in situ approaches to visualize interactions in their native context

  • In vivo modeling:

    • Challenge: Effective delivery of modulatory agents

    • Solution: Develop tissue-specific delivery systems, employ controlled release mechanisms, and optimize vector design for enhanced transduction efficiency in target tissues

How can researchers integrate multi-omics approaches to better understand PAPPA-AS1 function in disease states?

Comprehensive understanding of PAPPA-AS1 function requires integration of multiple omics approaches:

  • Transcriptomics integration:

    • RNA-seq to identify co-regulated genes and networks

    • Single-cell transcriptomics to resolve cell type-specific expression patterns

    • Spatial transcriptomics to map expression within tissue architecture

    • Long-read sequencing to identify potential isoforms or variants

  • Epigenomic correlation:

    • ChIP-seq to identify regulatory elements controlling PAPPA-AS1 expression

    • ATAC-seq to assess chromatin accessibility at the PAPPA-AS1 locus

    • DNA methylation analysis to determine epigenetic regulation

    • Histone modification mapping to understand chromatin context

  • Proteomics applications:

    • Comprehensive identification of PAPPA-AS1 binding partners

    • Phosphoproteomics to map signaling cascades affected by PAPPA-AS1

    • Quantitative proteomics to assess proteome-wide changes following PAPPA-AS1 modulation

    • Spatial proteomics to determine subcellular impacts

  • Metabolomics insights:

    • Identify metabolic pathways affected by PAPPA-AS1-mediated signaling

    • Assess potential biomarkers associated with PAPPA-AS1 dysregulation

    • Evaluate metabolic consequences of TLR4/MyD88 pathway modulation

  • Computational integration:

    • Network analysis to identify regulatory hubs and interactions

    • Machine learning approaches to predict functional relationships

    • Systems biology modeling to understand pathway dynamics

    • Multi-omics data visualization tools for comprehensive interpretation

This integrated approach provides a systems-level understanding of PAPPA-AS1 function that cannot be achieved through any single methodology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.