Recombinant Human Protein reprimo (RPRM)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
RPRM; Protein reprimo
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIA VMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY
Uniprot No.

Target Background

Function
Reprimo (RPRM) may be involved in the regulation of p53-dependent G2 arrest of the cell cycle. It appears to induce cell cycle arrest by inhibiting CDK1 activity and nuclear translocation of the CDC2 cyclin B1 complex.
Gene References Into Functions
  1. Drawing on embryonic and adult expression patterns, the potential relevance of RPRM and RPRML in cancer is investigated. Active research in the coming years should contribute to novel translational applications of this gene family as potential biomarkers and in the development of novel cancer therapies. PMID: 29941787
  2. Reprimo methylation was observed more frequently in malignant intraductal papillary mucinous neoplasm (IPMN), suggesting a role for reprimo methylation in the malignant transformation of IPMNs. PMID: 29401170
  3. Data suggest that ERalpha expression in breast cancer may affect the DNA methylation of the CpG-island in the RPRM gene. PMID: 28809778
  4. Tissue-specific expression patterns of the RPRM transcripts and protein are conserved between zebrafish and humans. This suggests the zebrafish as a valuable model for elucidating both the physiological and pathological roles of the RPRM gene family. PMID: 28562620
  5. Results indicate that RPRM promoter methylation is strongly associated with gastric cancer. PMID: 27992600
  6. The DNA methylation of both Reprimo and hMLH1 genes reduced protein expression and may contribute to the development and progression of gastric cancer. PMID: 26823831
  7. The p53-dependent G2 arrest mediator candidate gene, Reprimo, is down-regulated by promoter hypermethylation in pediatric acute myeloid leukemia. PMID: 25629980
  8. A positive association between RPRM and p73 expression suggests that other members of the p53 gene family may be involved in the regulation of RPRM expression. PMID: 25954972
  9. Loss of expression of Reprimo (RPRM), a p53-induced cell cycle arrest gene, correlates with invasive tumor progression and p73 expression in gastric cancer. This suggests that other members of the p53 gene family may be involved in the regulation of RPRM expression. PMID: 25954972
  10. Reprimo expression is normally induced in response to DNA damage, acting as a tumor suppressor in gastric cancer. However, Reprimo methylation abolishes its expression and effects. PMID: 23982217
  11. This study concludes that LMP-1 may induce cell cycle arrest at G(2)/M progression via upregulation of 14-3-3sigma and Reprimo. PMID: 23312294
  12. RPRM is transiently up-regulated at a posttranscriptional level in times of cellular stress to restrict cell survival, proliferation, and tumor formation. PMID: 22562171
  13. Loss of Reprimo and S100A2 expressions is common in gastric adenocarcinomas. The expressions of Reprimo and S100A2 may be potential biomarkers for detecting gastric adenocarcinomas. PMID: 20949468
  14. These data suggest a novel role for HDAC7 and FoxA1 in estrogen repression of RPRM. PMID: 19917725
  15. Results indicate that aberrant methylation of Reprimo is a frequent event in pancreatic carcinogenesis and is linked to genetic instability. PMID: 16752411
  16. An association between the Reprimo 824G>C heterozygote and diverticular disease may exist based on deviation from Hardy-Weinberg equilibrium. PMID: 18197409
  17. Aberrant hypermethylation of Reprimo is prevalent in primary gastric cancer as well as paired plasma samples. In plasma from asymptomatic controls, Reprimo is infrequently methylated. Reprimo is a potential biomarker for early detection of gastric cancer. PMID: 18829507

Show More

Hide All

Database Links

HGNC: 24201

OMIM: 612171

KEGG: hsa:56475

STRING: 9606.ENSP00000314946

UniGene: Hs.100890

Protein Families
Reprimo family
Subcellular Location
Cytoplasm. Membrane; Single-pass membrane protein.

Q&A

What is Reprimo (RPRM) and what are its primary biological functions?

Reprimo (RPRM) is a tumor suppressor gene that encodes a protein playing critical roles in multiple cellular processes. RPRM functions primarily in DNA damage response pathways and cell cycle regulation. It is variably expressed across different tissues, with notably abundant expression in the brain . RPRM has been identified as a target gene of p53, the master regulator of cancer suppression . Recent research has revealed that RPRM protein is secreted from cells and can extrinsically induce apoptosis in recipient cells, indicating its role in intercellular signaling for tumor suppression .

How is RPRM expression distributed across different tissues?

RPRM demonstrates variable expression patterns across human tissues, with the brain being one of the organs with the most abundant RPRM expression . This tissue-specific expression pattern suggests differential roles for RPRM depending on the cellular context. The high expression in brain tissue has prompted investigations into its neurological functions, with evidence suggesting it may be essential for brain development and function .

What signaling pathways does RPRM interact with and regulate?

RPRM interacts with several critical signaling pathways:

  • DNA Damage Response Pathway: RPRM plays an important role in DNA damage repair through its negative regulatory effect on the ataxia-telangiectasia-mutated (ATM) protein kinase .

  • p53-Reprimo-Hippo-YAP/TAZ-p73 Axis: RPRM functions downstream of p53 and upstream of the Hippo-YAP/TAZ-p73 pathway to induce apoptosis and tumor suppression .

  • Extrinsic Apoptosis Pathway: As a secreted protein, RPRM can bind to specific receptor molecules on recipient cells and induce apoptosis via the Hippo signaling pathway .

How does RPRM function as a tumor suppressor?

RPRM exhibits tumor suppressor functions through multiple mechanisms:

  • Direct Intracellular Mechanisms: RPRM is involved in cell cycle regulation and DNA damage response pathways, helping to prevent the proliferation of damaged cells .

  • Extrinsic Apoptosis Induction: Recent research has demonstrated that RPRM is secreted from cells and can induce apoptosis in recipient cells. This occurs through binding to specific receptors (FAT1, FAT4, CELSR1, CELSR2, and CELSR3) from the protocadherin family .

  • Activation of Proapoptotic Genes: After binding to its receptors, RPRM activates the Hippo-YAP/TAZ-p73 axis, leading to the transactivation of various proapoptotic genes .

This multi-faceted approach to tumor suppression makes RPRM an important player in preventing cancer development and progression.

What experimental models are most effective for studying RPRM function?

Several experimental models have proven valuable for RPRM research:

  • RPRM Knockout Mouse Model: This has been particularly useful for studying the in vivo effects of RPRM deletion. For example, RPRM knockout mice showed reduced radiation-induced brain injury compared to wild-type mice .

  • Primary Cell Cultures: Both primary microglial cells and primary neurons from RPRM knockout mice have been used to study RPRM's role in radiation-induced DNA damage and apoptosis .

  • In vitro Secretion Assays: These have been employed to demonstrate that RPRM is secreted from cells and can act on recipient cells .

When selecting an experimental model, researchers should consider the specific aspect of RPRM function they wish to investigate and choose accordingly.

What methodological considerations are important when designing experiments to study RPRM?

When designing experiments to study RPRM, researchers should consider:

  • Tissue-Specific Expression: Given RPRM's variable expression across tissues, experimental designs should account for tissue-specific effects .

  • Temporal Dynamics: For radiation studies, time points after exposure are critical. For example, DNA damage can be assessed at 6 hours post-irradiation .

  • Appropriate Controls: When using knockout models, proper wild-type controls are essential. For secretion studies, controls to distinguish between direct and indirect effects are necessary .

  • Detection Methods: Using appropriate markers for specific processes (e.g., γ-H2AX for DNA damage, cleaved caspase-3 for apoptosis) is crucial for accurate data interpretation .

  • Experimental Design Validity: Researchers should consider both internal and external validity factors when designing experiments, including history effects, maturation processes, testing effects, and instrumentation changes that could confound results .

How does RPRM influence radiation-induced brain injury (RIBI)?

Recent research has revealed that RPRM plays a significant role in radiation-induced brain injury (RIBI). In an RPRM knockout mouse model, RPRM deletion significantly alleviated RIBI through multiple mechanisms:

  • Reduced DNA Damage: RPRM knockout mice showed significantly lower levels of γ-H2AX (a marker for DNA damage) in hippocampal cells after whole-brain irradiation compared to wild-type mice .

  • Decreased Apoptosis: Hippocampal cells from RPRM knockout mice exhibited reduced apoptosis markers (cleaved caspase-3) following radiation exposure .

  • Diminished Microglial Activation: RPRM deletion protected microglia against radiation-induced DNA damage, with RPRM knockout mice showing approximately half the number of damaged microglia compared to wild-type mice .

  • Neuronal Protection: Neuronal cells in RPRM knockout mice displayed 19% less DNA damage and 62% less apoptosis at 6 hours post-whole-brain irradiation .

These findings suggest that targeting RPRM could potentially be a preventive and therapeutic strategy for RIBI.

What are the comparative effects of RPRM deletion on different cell types following radiation exposure?

The effects of RPRM deletion on radiation response vary across cell types as shown in the following table:

Cell TypeParameter MeasuredReduction in RPRM KO vs WTTime PointRadiation Dose
Hippocampal neuronsDNA damage (γ-H2AX)19%6h post-WBI10 Gy
Hippocampal neuronsApoptosis (cleaved caspase-3)62%6h post-WBI10 Gy
Primary neurons (in vitro)DNA damage (γ-H2AX)25%6h post-IR50 Gy
MicrogliaDNA damage (Iba-1+/γH2AX+ cells)~50%6h post-WBI10 Gy
Primary microglia (in vitro)DNA damage (γ-H2AX)44%6h post-IRNot specified

This data demonstrates that RPRM deletion provides differential protection against radiation-induced damage, with particularly strong effects on reducing neuronal apoptosis and microglial DNA damage .

What is the mechanism by which secreted RPRM induces apoptosis in recipient cells?

Recent research has uncovered a novel mechanism by which RPRM functions as a tumor suppressor. The RPRM protein is secreted from cells and can induce apoptosis in recipient cells through the following pathway:

  • Receptor Binding: Secreted RPRM specifically binds to members of the protocadherin family—FAT1, FAT4, CELSR1, CELSR2, and CELSR3—which function as receptors on recipient cells .

  • Hippo Pathway Activation: Upon binding to these receptors, RPRM activates the Hippo signaling pathway .

  • YAP/TAZ-p73 Axis: This activation impacts the YAP/TAZ-p73 axis, a downstream component of the Hippo pathway .

  • Proapoptotic Gene Transactivation: The activated pathway leads to the transactivation of various proapoptotic genes, ultimately resulting in apoptosis of the recipient cell .

This extrinsic apoptosis mechanism represents a p53-Reprimo-Hippo-YAP/TAZ-p73 axis that plays a crucial role in tumor suppression .

How might RPRM's tumor suppressive function be harnessed for cancer therapy?

RPRM's unique properties as a secreted tumor suppressor protein present several potential avenues for cancer therapeutic development:

  • Recombinant Protein Therapy: The development of recombinant RPRM protein could potentially be used as a biological therapy to induce apoptosis in cancer cells .

  • Receptor Targeting: Since specific receptors for RPRM have been identified (FAT1, FAT4, CELSR1, CELSR2, and CELSR3), these could serve as targets for developing agonists that mimic RPRM binding and activate downstream apoptotic pathways .

  • Pathway Modulation: Understanding the p53-Reprimo-Hippo-YAP/TAZ-p73 axis provides opportunities to develop therapeutics that modulate this pathway in cancer cells resistant to conventional treatments .

  • Combination Therapy: RPRM-based therapies might be particularly effective in combination with radiation therapy, given RPRM's involvement in DNA damage response pathways .

As noted in recent research, the discovery of RPRM as an "innate tumor eliminator" and its downstream pathway "offers a promising avenue for the pharmacological treatment of cancer" .

What contradictions or paradoxes exist in current RPRM research?

One significant paradox in RPRM research presents itself when comparing its roles in cancer suppression versus radiation injury:

  • Dual Role in Different Contexts: While RPRM functions as a tumor suppressor gene with its presence being beneficial for cancer prevention , its deletion actually protects against radiation-induced brain injury . This presents a therapeutic dilemma when considering treatments for brain tumors that might involve radiation.

  • Cell Type-Specific Effects: The degree of protection afforded by RPRM deletion varies significantly between cell types, with neuronal apoptosis showing a 62% reduction while neuronal DNA damage is only reduced by 19% . This disparity suggests complex downstream signaling differences that are not fully understood.

  • Context-Dependent Expression: Despite being a tumor suppressor, RPRM is abundantly expressed in the brain , which is not typically associated with high cell turnover or cancer risk, suggesting additional non-cancer-related functions that require further investigation.

What are the key technical challenges in studying RPRM function and potential solutions?

Researchers face several technical challenges when studying RPRM:

  • Detecting Secreted Protein: Since RPRM functions as a secreted protein , traditional intracellular protein detection methods may miss its activity.

    • Solution: Implement medium concentration techniques and specific immunoassays designed to detect extracellular proteins.

  • Temporal Dynamics: RPRM's effects may vary significantly at different time points after stimuli like radiation .

    • Solution: Design time-course experiments with multiple sampling points to capture the full spectrum of responses.

  • Model System Limitations: Cell culture models may not fully recapitulate the complex in vivo environment where RPRM functions.

    • Solution: Combine in vitro studies with in vivo models, and consider organoid systems that better mimic tissue architecture and cellular interactions.

  • Experimental Design Validity: As with any research, issues of internal and external validity can confound results .

    • Solution: Implement rigorous experimental designs that control for potential confounding variables such as history effects, maturation processes, testing effects, and instrumentation changes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.