Recombinant Human Protein RER1 (RER1)

Shipped with Ice Packs
In Stock

Description

Introduction

Retention in Endoplasmic Reticulum-1 (RER1) is an evolutionarily conserved protein found in organisms ranging from yeast to mammals . RER1 is a sorting receptor involved in the retention and retrieval of unassembled subunits of large oligomeric membrane protein complexes within the endoplasmic reticulum (ER) . It plays a crucial role in ER homeostasis, protein complex assembly, and the regulation of protein trafficking .

Function and Role of RER1

RER1 is essential for maintaining protein homeostasis and the proper transport of proteins between the ER and the Golgi apparatus . Studies have shown that RER1 is required for the assembly of multi-subunit protein complexes, such as the γ-secretase complex, yeast iron transporter, and skeletal muscle nicotinic acetylcholine receptor (nAChR) .

In Drosophila, RER1 is essential for maintaining protein homeostasis, and its loss activates stress-induced unfolded protein responses . RER1 deficiency induces ER stress and activates the UPR pathways in yeast, worms, and mouse cerebral cortex, suggesting a well-conserved function across species .

RER1 has been identified as an important protein that mediates ER-Golgi trafficking of Alzheimer’s disease (AD)-related proteins and significantly decreases amyloid-β (Aβ) production . Mammalian Rer1 has also been reported to regulate other proteins such as muscular acetylcholine receptors and Foxj1a, suggesting important roles in neuromuscular synapses and ciliogenesis .

RER1 and Protein Homeostasis

RER1 plays a vital role in maintaining protein homeostasis within the cell . Loss of RER1 leads to proteotoxic stress, which can result in cell competition and elimination of mutant cells . Studies have indicated that RER1 levels are upregulated upon Myc-overexpression, suggesting a connection between RER1 and Myc-induced proteostasis demand . Elevated RER1 levels are required for proper proteostasis during Myc-overexpression .

RER1 and Alpha-Synuclein (αSyn)

Research suggests that RER1 is a mediator of ubiquitin-proteasome system (UPS)-dependent αSyn degradation . Overexpression of RER1 significantly decreased levels of both wild type and mutant forms of αSyn, whereas a RER1 mutant had a significantly attenuated effect on αSyn . RER1 effects were specific to αSyn and had little to no effect on either βSyn or a αSyn mutant, which both lack the NAC domain sequence critical for synuclein fibrillization . RER1 also appears to interact with the ubiquitin ligase NEDD4 .

RER1 and Acetylcholine Receptor (AChR)

RER1 controls the surface expression of AChRα in vitro . Knockdown of RER1 led to decreased AChRα levels at the plasma membrane . A lack of RER1 led to the escape of unassembled subunits out of the ER to the plasma membrane, explaining the change in the ratio of assembled/unassembled AChRα at the plasma membrane . In the absence of RER1, AChRα escapes from the ER and is then degraded in lysosomes .

RER1 and Disease

RER1 has been implicated in several diseases, including Alzheimer’s disease and Parkinson’s disease . It has also been shown to enhance the progression of prostate cancer through promoting cell proliferation, migration, and aggressiveness .

RER1 and Cell Proliferation

RER1 is essential for maintaining protein homeostasis and competitive cell survival in developing tissue . Loss of RER1 creates proteotoxic stress in developing wing epithelium, and the clonal population of rer1 mutant cells attained the loser fate and were eliminated specifically via the process of cell competition when surrounded by wild-type cells . Loss of RER1 is sufficient to suppress Myc-induced overgrowth .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your own protocols.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RER1; Protein RER1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-196
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
RER1
Target Protein Sequence
MSEGDSVGESVHGKPSVVYRFFTRLGQIYQSWLDKSTPYTAVRWVVTLGLSFVYMIRVYL LQGWYIVTYALGIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFK FWHAATKGILVAMVCTFFDAFNVPVFWPILVMYFIMLFCITMKRQIKHMIKYRYIPFTHG KRRYRGKEDAGKAFAS
Uniprot No.

Target Background

Function

RER1 participates in the retrieval of endoplasmic reticulum (ER) membrane proteins from the early Golgi compartment.

Gene References Into Functions

Key Research Findings on RER1 Function:

  1. RER1's potential role as a mediator of elevated alpha-synuclein levels. PMID: 28877262
  2. RER1's regulation of ER retention of immature or misfolded rhodopsin and modulation of its intracellular trafficking. PMID: 25096327
  3. RER1's involvement in the ER retention and degradation of Charcot-Marie-Tooth disease-related PMP22. PMID: 25385046
  4. The effect of RER1 depletion on ciliary length and function through modulation of Notch signaling. PMID: 23479743
  5. Synoviolin's upregulation of amyloid-beta production via RER1 degradation. PMID: 23129766
  6. RER1's modulation of amyloid-beta production by altering gamma-secretase and amyloid precursor protein trafficking. PMID: 23043097
  7. RER1's interaction with Pen2 and its role in regulating Pen2 localization and stability. PMID: 17668005
Database Links

HGNC: 30309

KEGG: hsa:11079

STRING: 9606.ENSP00000302088

UniGene: Hs.525527

Protein Families
RER1 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is RER1 and what are its primary cellular functions?

RER1 is a multi-pass membrane protein that functions as an essential component for retention and retrieval of proteins in the early secretory pathway. The primary functions of RER1 include:

  • Retrieval of endoplasmic reticulum (ER) membrane proteins from the early Golgi compartment

  • Regulation of ER retention of immature or misfolded proteins

  • Modulation of protein complex assembly, particularly for multi-subunit membrane protein complexes

  • Quality control for membrane proteins in the early secretory pathway

Human RER1 consists of 196 amino acids, corresponding to a molecular mass of approximately 23 kDa, and shares 44% identity and 65% similarity with yeast Rer1 protein . The protein contains four putative transmembrane domains that form a W-topology with both N- and C-termini facing the cytosol .

Where is RER1 localized in human cells?

Human RER1 is primarily localized to the Golgi apparatus and peripheral elements of the ER-Golgi interface . This localization has been confirmed through multiple experimental approaches:

  • Double immunofluorescence microscopy

  • Immunoelectron microscopy of thawed cryosections

  • Subcellular distribution analysis with organelle markers

Interestingly, under conditions of brefeldin A treatment, human RER1 redistributes together with recycling Golgi proteins, demonstrating its dynamic behavior within the secretory pathway . High overexpression of RER1 can lead to its relocation to ER-like structures together with KDEL-receptor and can affect the structural organization of the Golgi apparatus .

What expression systems are used to produce recombinant human RER1?

Multiple expression systems have been employed to produce recombinant human RER1 protein:

Expression SystemAdvantagesCommon ApplicationsProduct Characteristics
HEK293T cellsNative-like post-translational modifications, proper foldingFunctional studies, interaction analysesFull-length protein, often tagged (C-Myc/DDK)
E. coliHigh yield, cost-effectiveAntibody production, blocking assaysTypically fragments or domains, His-tagged

The choice of expression system depends on the experimental requirements. For structural studies or functional assays, mammalian expression systems are preferred to ensure proper folding and modifications . For applications requiring specific protein fragments, such as antibody validation, bacterial expression systems can be more efficient .

How can recombinant RER1 be used in protein interaction studies?

Recombinant RER1 can be utilized in various protein interaction studies to investigate its role in protein trafficking:

  • Co-immunoprecipitation assays: Using tagged recombinant RER1 to pull down interacting partners from cell lysates. This approach has successfully identified interactions with:

    • Wild-type and mutant rhodopsin

    • Components of the γ-secretase complex

    • Mutant peripheral myelin protein 22 (PMP22)

  • In vitro binding assays: Purified recombinant RER1 can be used in GST pull-down or surface plasmon resonance (SPR) experiments to assess direct interactions and binding kinetics.

  • Competition assays: Recombinant RER1 fragments can be used to compete with endogenous RER1 for binding to target proteins, helping map interaction domains.

When designing interaction experiments, researchers should consider using mild detergents to maintain membrane protein interactions and include appropriate controls to distinguish specific from non-specific interactions .

How does RER1 contribute to protein quality control in the secretory pathway?

RER1 functions as a critical component of protein quality control through two primary mechanisms:

  • Retrieval function: RER1 recognizes specific motifs in proteins that have escaped the ER and facilitates their retrieval from the early Golgi back to the ER . This process is particularly important for:

    • Misfolded proteins that need ER retention for potential refolding

    • Subunits of multi-protein complexes awaiting assembly partners

    • ER-resident proteins that have escaped their normal location

  • Retention function: RER1 can directly contribute to the retention of certain proteins in the ER, preventing their forward transport through the secretory pathway .

Experimental evidence demonstrates these functions in multiple systems:

  • In studies with rhodopsin, RER1 regulates wild-type rhodopsin trafficking and specifically mediates the ER retention of the G51R rhodopsin mutant

  • Knockdown of RER1 increases the transport of wild-type rhodopsin and allows G51R mutant rhodopsin to escape to the plasma membrane or lysosomes

  • In Charcot-Marie-Tooth disease models, RER1 works alongside calnexin to trap disease-related PMP22(L16P) in the ER

These findings highlight RER1's role as a "sorting chaperone" that modulates the fate of various membrane proteins in the early secretory pathway.

What experimental approaches are effective for studying RER1-mediated protein trafficking?

To investigate RER1-mediated protein trafficking, researchers can employ several complementary approaches:

  • Loss-of-function and gain-of-function studies:

    • siRNA or shRNA knockdown of RER1 to assess effects on protein localization and trafficking

    • Overexpression of wild-type or tagged RER1 to examine retention effects

    • Rescue experiments with siRNA-resistant RER1 constructs to confirm specificity

  • Protein localization and trafficking assays:

    • Immunofluorescence microscopy to visualize subcellular distribution of cargo proteins

    • Cell surface biotinylation to quantify plasma membrane localization of proteins

    • Live-cell imaging with fluorescently tagged proteins to monitor dynamic trafficking

  • Biochemical approaches:

    • Subcellular fractionation to isolate and analyze different compartments

    • Glycosidase sensitivity assays (EndoH vs. PNGaseF) to determine protein trafficking through the Golgi

    • Cycloheximide chase experiments to distinguish trafficking from new protein synthesis

A successful experimental design might combine RER1 knockdown with cell surface biotinylation and confocal microscopy to provide both biochemical and visual evidence of altered protein trafficking, as demonstrated in studies of rhodopsin trafficking .

How does RER1 contribute to the pathophysiology of protein misfolding diseases?

RER1 plays a significant role in several protein misfolding diseases through its function in quality control:

  • Charcot-Marie-Tooth disease: RER1 participates in trapping disease-related PMP22(L16P) mutant in the ER through calnexin-dependent ER retention and RER1-mediated early Golgi retrieval . Simultaneous knockdown of RER1 and calnexin leads to more pronounced release of PMP22(L16P) from the ER than knockdown of each gene individually .

  • Retinitis pigmentosa: RER1 regulates the ER retention of certain rhodopsin mutants, such as G51R . Depletion of RER1 results in the release of this mutant from the ER to the plasma membrane or lysosomes .

  • Neurodegenerative disorders: RER1 modulates γ-secretase complex assembly and function by interacting with unassembled nicastrin and PEN-2, which has implications for Alzheimer's disease pathology .

These findings suggest that RER1's role in disease pathophysiology may be mutation-specific and depends on the nature of the protein misfolding.

How can experimental design address the contradictory effects of RER1 on different mutant proteins?

Studies have shown that RER1 exhibits differential effects on various mutant proteins, presenting an experimental challenge. For example, RER1 knockdown allows G51R rhodopsin mutant to reach the plasma membrane but has minimal effect on P23H and L40R rhodopsin mutants . To address these contradictions, researchers should:

  • Design comparative studies with multiple mutants:

    • Analyze multiple mutations within the same protein (as done with different rhodopsin mutants)

    • Include wild-type proteins as controls

    • Quantify trafficking effects using consistent metrics across experiments

  • Investigate domain-specific interactions:

    • Use domain mapping to identify which regions of RER1 interact with different mutants

    • Create chimeric proteins to determine which features confer RER1 sensitivity

    • Implement site-directed mutagenesis to alter potential interaction sites

  • Employ multiple methodological approaches:

    • Combine visual techniques (immunofluorescence) with quantitative biochemical assays (surface biotinylation)

    • Use complementary overexpression and knockdown experiments

    • Implement rescue experiments with specific domains to identify functional regions

When analyzing data from such experiments, researchers should consider:

  • Quantitative analysis of subcellular distribution

  • Statistical comparison across multiple mutants

  • Correlation between protein structure/mutation location and RER1 effects

What are the critical controls when using recombinant RER1 in experimental studies?

When working with recombinant RER1 protein, several critical controls should be implemented:

  • Protein quality controls:

    • Verify purity by SDS-PAGE and Coomassie blue staining (aim for >80% purity)

    • Confirm protein identity using mass spectrometry or Western blotting

    • Assess proper folding through functional assays (e.g., binding to known partners)

  • Application-specific controls:

    • For blocking experiments with antibodies: Use a 100x molar excess of the protein fragment based on concentration and molecular weight

    • Include irrelevant recombinant proteins of similar size as negative controls

    • For functional complementation: Test with known RER1-dependent and independent cargoes

  • Experimental system validation:

    • When using tagged RER1 constructs, verify that tags do not interfere with function or localization

    • For knockdown/knockout studies, include rescue experiments with recombinant RER1

    • When studying trafficking, include Brefeldin A treatment as a positive control for Golgi disruption

How should researchers design experiments to study the functional activity of recombinant human RER1?

Designing experiments to assess the functional activity of recombinant human RER1 requires careful consideration:

  • Complementation assays:

    • Use RER1-deficient cells (through CRISPR knockout or siRNA knockdown)

    • Introduce recombinant RER1 and assess rescue of phenotypes

    • Measure recovery of proper localization of known RER1-dependent cargoes

  • Trafficking assays:

    • Monitor localization of model cargoes (e.g., rhodopsin, PMP22) in the presence/absence of recombinant RER1

    • Quantify surface expression using biotinylation assays or flow cytometry

    • Track protein movement using live-cell imaging with fluorescently tagged proteins

  • Structure-function analysis:

    • Generate domain deletions or point mutations in recombinant RER1

    • Assess which domains are required for different functions (Golgi localization, cargo binding)

    • Create chimeric proteins with domains from other species to identify conserved functional regions

The functional activity of recombinant human RER1 can be validated through complementation of RER1 deletion in model systems, as demonstrated with myc-tagged human RER1 complementing yeast Rer1p function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.