Recombinant Human Protein SCAI (SCAI)

Shipped with Ice Packs
In Stock

Description

Introduction

SCAI, or Suppressor of Cancer Cell Invasion, is a highly conserved protein among vertebrates that has been implicated in transcriptional regulation . It lacks annotated domains and shares little sequence homology with other proteins . Research has shown that SCAI plays a significant role in DNA double-strand break (DSB) repair, response to UV-induced replicative stress, and error-free repair of DNA interstrand crosslinks (ICLs) .

SCAI's Role in DNA Repair

SCAI promotes DNA double-strand break repair through both non-homologous end-joining (NHEJ) and homologous recombination (HR) pathways, which are essential for maintaining genome integrity after DNA damage .

  • DSB Repair: SCAI is enriched at DSB sites through 53BP1-dependent recruitment to DSB-surrounding chromatin and 53BP1-independent accumulation at resected DSBs . Cells lacking SCAI show reduced DSB repair capacity, increased sensitivity to DSB-inflicting agents, and genome instability . SCAI facilitates ATM kinase signaling at DSBs in repressive chromatin environments, acting as a mediator of 53BP1-dependent repair of heterochromatin-associated DSBs .

  • UV-Induced Replicative Stress Response: SCAI functions as a regulator of the replicative stress response caused by UV exposure . Cells with SCAI knocked down or knocked out exhibit elevated RPA-ssDNA post-UV, suggesting its involvement in the response to replicative stress . SCAI colocalizes with stalled replication forks, and its depletion promotes nascent DNA degradation. SCAI inhibits EXO1 activity on a single-stranded DNA gap in vitro, indicating its role in preventing excessive DNA resection .

  • ICL Repair: SCAI plays a critical role in ICL repair via the FA pathway . Mass spectrometry analysis has identified interactions between SCAI and Fanconi Anemia (FA) proteins, as well as transcription and chromatin remodeling factors. SCAI interacts with all five subunits of the polymerase ζ (Polζ) complex (REV1, REV3, REV7, POLD2, and POLD3) .

SCAI and Cancer Cell Invasion

SCAI was initially identified as a suppressor of cancer cell invasion . High SCAI expression is associated with papillary thyroid cancer cells .

SCAI-Interacting Proteins

ProteinFunction
53BP1DNA damage response; Required for SCAI recruitment to DSB sites
HP1β (Cbx1)Heterochromatin-associated factor
HP1α (Cbx5)Heterochromatin-associated factor
REV1, REV3LDNA repair/replicative stress responses
MCM10DNA repair/replicative stress responses
BRCA2DNA repair/replicative stress responses; Involved in homologous recombination
PLK1DNA repair/replicative stress responses
SLX4DNA repair/replicative stress responses
UBR5DNA repair/replicative stress responses
CLASPINDNA repair/replicative stress responses
REV7, POLD2, POLD3Subunits of the polymerase ζ (Polζ) complex; Involved in ICL repair

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, we prioritize specific tag requests if communicated in advance.
Synonyms
SCAI; C9orf126; Protein SCAI; Suppressor of cancer cell invasion protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-606
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SCAI
Target Protein Sequence
MVRGARQPQQPRSRLAPRLTGTVEKPPRKRRSRTEFALKEIMSSGGAEDDIPQGERKTVT DFCYLLDKSKQLFNGLRDLPQYGQKQWQSYFGRTFDVYTKLWKFQQQHRQVLDNRYGLKR WQIGEIASKIGQLYYHYYLRTSETSYLNEAFSFYSAIRQRSYYSQVNKEDRPELVVKKLR YYARFIVVCLLLNKMDVVKDLVKELSDEIEDYTHRFNTEDQVEWNLVLQEVAAFIEADPV MVLNDDNTIVITSNRLAETGAPLLEQGMIVGQLSLADALIIGNCNNQVKFSELTVDMFRM LQALEREPMNLASQMNKPGMQESADKPTRRENPHKYLLYKPTFSQLYTFLAASFKELPAN SVLLIYLSATGVFPTGRSDSEGPYDFGGVLTNSNRDIINGDAIHKRNQSHKEMHCLHPGD LYPFTRKPLFIIVDSSNSVAYKNFTNLFGQPLVCLLSPTAYPKALQDQSQRGSLFTLFLN NPLMAFLFVSGLSSMRRGLWEKCQEYLRKINRDIAQLLTHSRSIDQAFLQFFGDEFLRLL LTRFIFCSATMRMHKIFRETRNYPESYPQLPRDETVENPHLQKHILELASILDVRNVFFE NTIDDY
Uniprot No.

Target Background

Function
SCAI is a tumor suppressor that inhibits MRTFA-induced SRF transcriptional activity. It may function within the RHOA-DIAPH1 signaling pathway, regulating cell migration via transcriptional control of ITGB1.
Gene References Into Functions
  1. High SCAI expression correlates with gastric, prostate, and colorectal cancers. PMID: 28815470
  2. Whole-genome and Sanger sequencing confirmed SMAD4 gene integration within the last intron of the SCAI gene in five cases. PMID: 28867604
  3. SCAI inhibits RIF1, enabling BRCA1-mediated DNA repair, potentially including alternative non-homologous end joining (alt-NHEJ), resection-dependent NHEJ in G1, and homologous recombination repair (HDR) in S/G2 phases. PMID: 28700933
  4. miR-625-3p exhibits oncogenic effects through regulation of the SCAI/E-cadherin/MMP-9 pathways. PMID: 26314959
  5. miR-1228 promotes breast cancer proliferation, invasion, and migration through MOAP1 and SCAI. PMID: 26261546
  6. SCAI downregulation enhances glioma cell invasion and cancer stem cell-like phenotypes by activating Wnt/β-catenin signaling. PMID: 24785374
  7. SCAI is a specific binding partner for KMD3B. PMID: 23593242
  8. SCAI is a transcriptional co-factor regulating epithelial-to-mesenchymal transition and renal fibrosis. PMID: 23178076
  9. Clinical trial data on gene-disease association and gene-environment interaction. (HuGE Navigator) PMID: 20379614
  10. SCAI suppression strongly upregulates β1-integrin expression. PMID: 19350017
Database Links

HGNC: 26709

KEGG: hsa:286205

STRING: 9606.ENSP00000362650

UniGene: Hs.59504

Protein Families
SCAI family
Subcellular Location
Membrane; Single-pass membrane protein. Nucleus. Cytoplasm.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.