Recombinant Human Protein SYS1 homolog (SYS1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Human Protein SYS1 Homolog (SYS1) is a multi-pass membrane protein implicated in protein trafficking and lipid biosynthesis. While structurally divergent from canonical β-catenins, it shares functional similarities with homologs in asymmetric cell division and membrane dynamics. This article synthesizes data from structural, functional, and disease-related studies to provide a detailed profile of SYS1.

Protein Trafficking and ARFRP1 Interaction

SYS1 is critical for trans-Golgi network (TGN) protein sorting and interacts with ARFRP1 (ADP-ribosylation factor-related protein 1), a GTPase regulating lipidation of chylomicrons and very low-density lipoproteins (VLDL). This interaction is essential for directing effector proteins to the TGN and maintaining lipid homeostasis .

Functional PartnerInteraction ScoreRole
ARFRP10.990TGN protein sorting, lipid metabolism

Glycosphingolipid Biosynthesis

SYS1 deficiency disrupts glycosphingolipid (GSL) metabolism, as shown in Vero cells. Knockout (KO) cells exhibit:

  • Reduced Gb3 (globotriaosylceramide): 41–47% of wild-type levels.

  • Accumulation of LacCer (lactosylceramide) and GlcCer (glucosylceramide), precursors of Gb3 .

GSL SpeciesSYS1-KO LevelParent Cell Level
Gb341–47%100%
LacCer614–638%100%
GlcCer993–1339%100%

Interaction Network

SYS1 partners with ARFRP1 to regulate TGN dynamics and lipid trafficking. Predicted interactions include:

  • ARFRP1: Critical for chylomicron/VLDL lipidation .

  • ARL1: A GTPase effector involved in membrane trafficking .

Disease Relevance

SYS1 deficiency confers resistance to Shiga toxin (STx) cytotoxicity by altering GSL profiles. In Vero cells, ΔSYS1 cells showed reduced Gb3 (STx receptor) and elevated LacCer, limiting toxin binding . Rescue with gRNA-resistant SYS1 restored sensitivity, confirming its role in GSL biosynthesis .

Research Applications

Recombinant SYS1 is used to study:

  • Protein trafficking pathways (e.g., ARFRP1-dependent sorting).

  • Lipid metabolism dysregulation in metabolic disorders.

  • Toxin resistance mechanisms (e.g., Shiga toxin).

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you require a specific format, please specify your needs during order placement. We will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SYS1; C20orf169; Protein SYS1 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SYS1
Target Protein Sequence
MAGQFRSYVWDPLLILSQIVLMQTVYYGSLGLWLALVDGLVRSSPSLDQMFDAEILGFST PPGRLSMMSFILNALTCALGLLYFIRRGKQCLDFTVTVHFFHLLGCWFYSSRFPSALTWW LVQAVCIALMAVIGEYLCMRTELKEIPLNSAPKSNV
Uniprot No.

Target Background

Function
Plays a role in protein trafficking. It may serve as a receptor for ARFRP1.
Database Links

HGNC: 16162

OMIM: 612979

KEGG: hsa:90196

STRING: 9606.ENSP00000243918

UniGene: Hs.655055

Protein Families
SYS1 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

How is SYS1 protein identified and recognized in experimental systems?

SYS1 protein can be identified using several reference identifiers used across different biological databases:

DatabaseIdentifierReference
UniProtQ8N2H4
PRO IDPR:Q8N2H4
Pharos TargetQ8N2H4
Open Targets IDENSG00000204070
STRING Protein ID9606.ENSP00000243918
WikidataQ21125287
neXtProt AccessionNX_Q8N2H4
HPA IDENSG00000204070
IntAct ProteinQ8N2H4
InterPro ProteinQ8N2H4

When designing experiments involving SYS1, researchers should use these identifiers for accurate protein targeting and verification. The protein can be detected using specific antibodies in techniques such as Western blotting, immunoprecipitation, or immunohistochemistry.

What are the recommended methods for expressing recombinant SYS1 protein?

While specific expression protocols for SYS1 are not detailed in the search results, the methodological approach for recombinant membrane protein expression can be adapted from similar proteins. Based on established protocols for other recombinant proteins , the following methodology is recommended:

  • Expression System Selection: Due to SYS1's nature as a membrane protein, mammalian expression systems (HEK293 or CHO cells) are preferable to maintain proper folding and post-translational modifications.

  • Vector Design: Create an expression construct containing:

    • The complete SYS1 coding sequence

    • An appropriate promoter (e.g., CMV)

    • A purification tag (His-tag or FLAG-tag)

    • A cleavable signal sequence if necessary

  • Transfection and Expression:

    • Transfect mammalian cells using lipid-based reagents

    • For stable expression, select transfected cells with appropriate antibiotics

    • Induce expression and monitor protein levels

  • Membrane Protein Extraction:

    • Use gentle detergents (e.g., DDM, CHAPS) for membrane solubilization

    • Perform extraction at 4°C to prevent protein degradation

  • Purification:

    • Employ affinity chromatography based on the attached tag

    • Follow with size-exclusion chromatography for higher purity

How can researchers effectively design single-subject experimental designs (SSEDs) for SYS1 functional studies?

When investigating SYS1 function in cellular systems, single-subject experimental designs can provide valuable insights into protein behavior under various conditions. Based on SSED principles , researchers should:

  • Establish Baseline Measurement:

    • Monitor cellular localization and trafficking patterns under normal conditions

    • Collect multiple baseline data points to establish stable patterns

    • Ensure measurement consistency and reliability

  • Implement Intervention Phase:

    • Introduce manipulations such as gene knockdown, point mutations, or drug treatments

    • Maintain consistent measurement parameters across phases

    • Allow sufficient time for effects to manifest

  • Analysis of Effects:

    • Examine changes in level, trend, and variability as shown in SSED methodology

    • Look for clear separation between baseline and intervention phases

    • Consider latency of effects when interpreting results

  • Implement Replication:

    • Internal replication through withdrawal and reintroduction of intervention

    • Systematic replication across different experimental conditions

    • Direct replication to confirm initial findings

This approach provides rigorous experimental control while accommodating the complexity of protein trafficking studies, allowing for valid inferences about SYS1 function.

What is known about SYS1's role in protein trafficking and its interaction with ARFRP1?

SYS1 is involved in protein trafficking mechanisms within the cell and may serve as a receptor for ARFRP1 (ADP-ribosylation factor-related protein 1) . While specific interaction details are not fully characterized in the search results, the functional relationship suggests several key points:

  • Golgi Localization: SYS1 is an integral membrane protein linking to the trans-Golgi network, indicating its involvement in the sorting and trafficking of proteins at this critical cellular compartment .

  • ARFRP1 Interaction: The potential receptor function for ARFRP1 suggests SYS1 may be involved in:

    • Recruiting ARFRP1 to specific membrane compartments

    • Facilitating ARFRP1-dependent vesicle formation or trafficking

    • Mediating the effects of ARFRP1 on Golgi structure and function

  • Trafficking Pathways: By association with Golgi membranes, SYS1 likely participates in:

    • Anterograde transport from Golgi to plasma membrane

    • Endosome-to-Golgi retrograde transport

    • Maintenance of Golgi architecture and function

Further investigation through co-immunoprecipitation, proximity ligation assays, and functional knockdown studies would help elucidate the specific mechanisms of SYS1-ARFRP1 interaction.

How does SYS1 compare functionally to other Golgi trafficking proteins?

While the search results don't provide direct comparisons, we can draw functional parallels between SYS1 and other Golgi trafficking proteins based on its classification as an integral membrane protein linking to the trans-Golgi network:

Protein FamilyRepresentative MembersShared Functions with SYS1Distinguishing Features
SNAREsSyntaxins, VAMPsMembrane localization, traffickingDirect membrane fusion roles
RabsRab6, Rab8Golgi-associated traffickingGTPase activity
Tethering FactorsGolgins, COG complexStabilization of transport intermediatesExtended coiled-coil structures
SYS1-likeSYS1Receptor for ARF-related proteinsSpecific ARFRP1 interaction

SYS1's unique position as a potential ARFRP1 receptor differentiates it from other trafficking proteins and suggests specialized functions in specific trafficking pathways that warrant further investigation.

What experimental approaches can resolve contradictory findings about SYS1 localization and function?

When faced with conflicting data regarding SYS1 localization or function, researchers should implement a multi-faceted experimental strategy:

  • Multiple Localization Methods:

    • Combine fluorescence microscopy with subcellular fractionation

    • Use proximity labeling techniques (BioID, APEX) to map the protein's microenvironment

    • Employ super-resolution microscopy for precise localization

  • Functional Redundancy Assessment:

    • Conduct genetic compensation analysis

    • Perform simultaneous knockdown of related proteins

    • Analyze synthetic genetic interactions

  • Context-Dependent Effects:

    • Test function across multiple cell types

    • Examine behavior under different physiological conditions

    • Assess impact of post-translational modifications

  • Rigorous Experimental Design:

    • Implement SSED principles with appropriate controls

    • Ensure replication across independent experiments

    • Follow the WWCH panel standards for evidence assessment

  • Data Integration:

    • Synthesize findings from multiple experimental approaches

    • Develop testable models to explain apparent contradictions

    • Consider computational approaches to integrate diverse datasets

How can researchers effectively study the dynamics of SYS1 in live cells?

To capture the dynamic behavior of SYS1 in trafficking pathways, researchers should consider these advanced approaches:

  • Live-Cell Imaging Techniques:

    • Generate fluorescent protein fusions (ensuring tag does not interfere with function)

    • Employ FRAP (Fluorescence Recovery After Photobleaching) to measure mobility

    • Use FRET-based sensors to detect protein-protein interactions in real-time

  • Pulse-Chase Analysis:

    • Implement RUSH (Retention Using Selective Hooks) system for synchronized trafficking

    • Apply photo-activatable or photo-convertible tags for temporal control

    • Track newly synthesized proteins through the secretory pathway

  • Quantitative Analysis:

    • Develop computational image analysis pipelines

    • Quantify dynamic parameters (diffusion coefficients, residence times)

    • Apply mathematical modeling to trafficking kinetics

  • Perturbation Approaches:

    • Use acute chemical inhibition for temporal precision

    • Implement optogenetic tools for spatiotemporal control

    • Apply temperature-sensitive trafficking blocks

These approaches provide complementary insights into SYS1 dynamics, revealing both steady-state distributions and rapid trafficking events that might be missed with fixed-cell techniques.

What are the most promising future research directions for SYS1?

Based on current knowledge about SYS1 and emerging techniques in protein research, several promising research directions emerge:

  • Structure-Function Studies:

    • Determine the three-dimensional structure of SYS1 through cryo-EM or X-ray crystallography

    • Map the binding interface with ARFRP1

    • Identify critical domains for membrane insertion and protein interactions

  • Trafficking Pathway Mapping:

    • Define the complete repertoire of SYS1-dependent cargo proteins

    • Elucidate the regulatory mechanisms controlling SYS1 activity

    • Investigate potential roles in specialized secretory pathways

  • Disease Associations:

    • Explore potential links between SYS1 mutations and trafficking disorders

    • Investigate SYS1 function in cancer cell biology

    • Assess impacts on neurodegenerative conditions with trafficking defects

  • Therapeutic Targeting:

    • Develop small molecule modulators of SYS1-ARFRP1 interaction

    • Explore potential for correction of trafficking defects

    • Consider application in targeted delivery systems

These directions build upon the foundation of basic SYS1 biology while extending into translational applications with potential clinical relevance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.