Recombinant Human Protein transport protein Sec61 subunit beta (SEC61B)

Shipped with Ice Packs
In Stock

Description

Molecular Properties

Recombinant SEC61B is typically expressed as a fragment (1–70 amino acids) or full-length (1–96 amino acids) protein, depending on the vector system. Key features include:

PropertyFull-Length (1–96 aa) Fragment (1–70 aa)
Expression SystemWheat germE. coli
Molecular Weight~9.4 kDa (fragment)~9.4 kDa
Purity>85% (SDS-PAGE)>85% (MS, SDS-PAGE)
ApplicationsELISA, Western blot (WB)SDS-PAGE, Mass spectrometry (MS)

Sequence: The N-terminal region contains motifs critical for interactions with ribosomes and auxiliary factors. For example, residues 1–70 include proline-flanked phosphorylation sites linked to regulatory functions .

Cotranslational vs. Posttranslational Transport

SEC61B is non-essential but kinetically enhances cotranslational translocation by stabilizing nascent chain insertion into the Sec61 channel . Key findings:

  • Mechanism: Facilitates ribosome binding to the Sec61 complex and transiently interacts with the signal peptidase complex (SPC25) during translocation initiation .

  • Phosphorylation: N-terminal phosphorylation (e.g., Ser/Thr residues flanked by prolines) modulates its activity. Mutations at these sites reduce translocation efficiency of substrates with suboptimal targeting sequences .

Auxiliary Interactions

SEC61B forms dynamic interactions with:

  • SPC25: Enhances signal peptidase recruitment to the translocation site, optimizing cleavage of signal peptides .

  • TRAM1: Cooperates with this translocating protein to import nascent chains into the ER .

Calcium Flux and ER Stress

SEC61B contributes to ER calcium leak, a phenomenon linked to platelet hyperactivity in diabetes:

  • Hyperglycemia Model: Overexpression of SEC61B increases cytosolic calcium flux and reduces protein synthesis in cultured cells and diabetic mice .

  • ER Stress: ER stress-induced upregulation of SEC61B correlates with platelet activation markers (e.g., p-IRE1) .

Disease Implications

DiseaseRole of SEC61BEvidence Source
DiabetesER stress-mediated calcium dysregulationMouse models
CancerOverexpression in glioblastoma linked to ER stress responseHuman tumors
ProteostasisPhosphorylation-dependent regulation of ER import for enzymes critical to protein foldingYeast models

Experimental Uses

ApplicationMethodologyOutcome
ELISAAntibody validation for SEC61BQuantitative detection
WBProtein expression analysisDetection of SEC61B in lysates
In Vitro TranslocationReconstituted proteoliposomesKinetic analysis of translocation efficiency
Phosphorylation StudiesMutagenesis + PIN1/Ess1 assaysIdentification of regulatory sites

Regulatory Mechanisms

Recent studies highlight SEC61B’s role in adapting to proteotoxic stress:

  • Ess1/PIN1 Dependency: Phosphorylation-induced conformational changes require the proline isomerase Ess1 (PIN1 in mammals) for optimal translocation of substrates with weak targeting signals .

  • ER Calcium Leak: SEC61B’s pore-forming capacity may be exploited therapeutically in conditions involving ER calcium dysregulation (e.g., diabetes) .

Limitations

  • Expression Variability: Full-length vs. fragment SEC61B constructs differ in functional assays (e.g., signal peptidase recruitment) .

  • Species-Specificity: Human SEC61B’s role in calcium flux remains to be validated in vivo .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize development of the specified tag.
Synonyms
SEC61B; Protein transport protein Sec61 subunit beta
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-96
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
PGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS
Uniprot No.

Target Background

Function
SEC61B is a component of the SEC61 channel-forming translocon complex, which mediates the transport of signal peptide-containing precursor polypeptides across the endoplasmic reticulum (ER). It is also a component of a ribosome-associated ER translocon complex involved in the transport of multi-pass membrane proteins into the ER membrane and their biogenesis. The SEC61 channel collaborates with the translocating protein TRAM1 to import nascent proteins into the ER. SEC61B is essential for PKD1/Polycystin-1 biogenesis.
Gene References Into Functions
  1. Whole exome sequencing in a discovery cohort of 102 unrelated patients, who were excluded for mutations in the two most common polycystic liver disease genes, PRKCSH and SEC63, identified heterozygous loss-of-function mutations in three additional genes: ALG8, GANAB, and SEC61B. Similar to PRKCSH and SEC63, these genes encode proteins that are integral to the protein biogenesis pathway in the endoplasmic reticulum. PMID: 28375157
  2. Sec61beta overexpression increased tight junction modulation rates, alongside enhanced delivery of claudin-4 from and to plasma membranes. PMID: 24882410
  3. Sec61beta-KD cells also exhibited altered ATP7A cellular distribution. PMID: 22710939
  4. SEC61beta and its autoantibody serve as biomarkers for colorectal cancer. PMID: 21255561
  5. Sec61beta function provides an alternative pathway for nuclear transport that can be utilized by membrane-embedded proteins such as full-length EGFR. PMID: 20937808
  6. This suggests that EGF receptors are trafficked from the endoplasmic reticulum to the nucleus via a novel pathway that involves the Sec61 translocon. PMID: 17215517

Show More

Hide All

Database Links

HGNC: 16993

OMIM: 609214

KEGG: hsa:10952

STRING: 9606.ENSP00000223641

UniGene: Hs.191887

Protein Families
SEC61-beta family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What experimental techniques are commonly used to detect and quantify SEC61B?

Several experimental approaches have been validated for SEC61B research:

  • Western Blotting (WB): Recombinant human SEC61B protein expressed in wheat germ has been validated for WB applications .

  • ELISA: Recombinant SEC61B protein can be used in enzyme-linked immunosorbent assays for quantitative detection .

  • Immunofluorescence: This technique has been successfully applied to detect SEC61B in platelets from hyperglycemic mice compared with control mice .

  • High-sensitivity unbiased proteomics: This approach has been used to consistently identify over 2,400 intracellular proteins, including detecting differential expression of SEC61B in clinical samples .

  • Cryo-electron microscopy: Although challenging due to its small size, cryo-EM has been used to study the SEC61 complex structure, though the density for SEC61β chain was weak in some studies .

How does SEC61B interact with other components of the translocation machinery?

SEC61B forms part of the heterotrimeric SEC61 complex along with SEC61α and SEC61γ. This complex interacts with several other components of the protein translocation machinery:

  • TRAP complex: The SEC61 complex associates with the translocon-associated protein (TRAP) complex. Cryo-EM studies have revealed binding of an ordered heterotetrameric TRAP complex to the ribosome-Sec61 assembly .

  • TRAM1: The SEC61 channel cooperates with the translocating protein TRAM1 to import nascent proteins into the ER .

  • Ribosome interactions: SEC61B contributes to the formation of a ribosome receptor on the ER membrane .

Interestingly, in studies of diabetes-associated platelet dysfunction, the quantity of SEC61B did not correlate with either of the other subunits of the SEC translocon or with other ER marker proteins (CANX, CALR, GRP78, UGGT1), suggesting potentially independent functions .

What is the role of SEC61B in calcium homeostasis and how can this be experimentally evaluated?

SEC61B has emerged as a novel regulator of calcium flux with significant implications for cellular function. Recent research has demonstrated:

  • ER calcium leak channel function: The SEC61 translocon can act as a passive ER calcium leak channel, with SEC61B playing a key role in this process .

  • Increased calcium flux with SEC61B overexpression: Cultured cells overexpressing SEC61B demonstrate increased calcium flux from the ER to the cytosol .

  • Disease relevance: Hyperglycemic mouse platelets mobilize more calcium to the cytosol compared with normoglycemic platelets, correlating with increased SEC61B expression .

Experimental approaches to evaluate SEC61B's role in calcium homeostasis include:

  • Calcium flux assays: Using calcium-sensitive fluorescent indicators to measure cytosolic calcium changes in cells with manipulated SEC61B expression.

  • Patch-clamp electrophysiology: To directly measure calcium currents through the SEC61 complex.

  • Calcium imaging in live cells: Using genetically encoded calcium indicators targeted to specific subcellular compartments.

  • ER calcium depletion assays: Using thapsigargin or similar agents to assess the contribution of SEC61B to steady-state ER calcium leak.

How is SEC61B expression altered in hyperglycemia and diabetes, and what experimental models are appropriate?

SEC61B expression shows significant alterations in hyperglycemic conditions with important implications for platelet function and potentially other cell types:

  • Increased expression in diabetes: Proteomic analysis of platelets from matched cohorts (34 people without diabetes, 42 people with type 2 diabetes) demonstrated increased SEC61B in patients with diabetes .

  • Correlation with glycemic control: SEC61B abundance showed significant positive correlation with serum fructosamine, a measure of glycemic control. This was the only protein among the top 100 lysate proteins to show this correlation .

  • Animal models confirm findings: Platelets from streptozotocin (STZ)-induced hyperglycemic C57Bl/6J mice had increased SEC61B by immunofluorescence compared with control mice .

Appropriate experimental models include:

  • Human platelet studies: Comparing matched cohorts of patients with and without diabetes.

  • STZ-induced diabetic mice: A well-established model for studying hyperglycemia effects.

  • In vitro hyperglycemia models: Culturing megakaryocytes or other cells in high glucose conditions.

  • Correlation analyses: Between SEC61B levels and clinical parameters of glycemic control.

What is the relationship between SEC61B expression and ER stress pathways?

SEC61B has been linked to endoplasmic reticulum stress responses, particularly through the IRE1 pathway:

  • Increased activation of IRE1 pathway: Phosphorylated IRE1 (p-IRE1), the active form generated upon ER stress, was significantly increased in diabetic platelets, correlating with increased SEC61B expression .

  • ER stress signaling attenuation: The SEC61 translocon has previously been shown to attenuate ER stress signaling through the IRE1 pathway .

  • Independent of ER expansion: The increase in SEC61B seen in hyperglycemia appears to be independent of ER expansion, as GRP78 (HSPA5, also known as BiP) levels remained similar between normal and high fructosamine platelets .

Experimental approaches to study this relationship include:

  • Western blotting for ER stress markers: Including p-IRE1, PERK, GRP78, and other UPR components.

  • XBP1 splicing assays: To assess IRE1 activity.

  • ER stress induction experiments: Using tunicamycin, thapsigargin, or other ER stress inducers to examine SEC61B regulation.

  • RNA sequencing: To comprehensively analyze UPR-related gene expression changes in relation to SEC61B levels.

What methodologies can be used to manipulate SEC61B expression for functional studies?

Several approaches can be employed to modulate SEC61B expression or function:

  • Genetic manipulation:

    • siRNA or shRNA for transient or stable knockdown

    • CRISPR-Cas9 for knockout or knock-in studies

    • Overexpression using plasmid transfection or viral vectors

  • Pharmacological modulation:

    • Natural product modulators of Sec61 function such as Coibamide A can serve as chemical probes

    • Compound CK147 has been shown to bind to Sec61 and alter its conformation

  • Recombinant protein approaches:

    • Using recombinant SEC61B protein (available as a full-length human protein expressed in wheat germ)

    • Dominant-negative mutants to disrupt function

  • In vitro reconstitution:

    • Purified components to reconstruct translocation systems with varying levels of SEC61B

How does SEC61B contribute to protein synthesis regulation?

Recent research has uncovered an unexpected role for SEC61B in protein synthesis regulation:

  • Reduced protein synthesis with SEC61B overexpression: Cultured cells overexpressing SEC61B showed decreased protein synthesis .

  • In vivo confirmation: Hyperglycemic mouse platelets had lower protein synthesis compared with normoglycemic platelets, correlating with increased SEC61B expression .

  • Mechanistic link: This effect may be connected to SEC61B's role in calcium flux and ER stress, as both processes can influence protein synthesis rates.

Methods to investigate SEC61B's impact on protein synthesis include:

  • Metabolic labeling: Using radioactive amino acids (35S-methionine) or non-radioactive analogs

  • Puromycin incorporation assays: To measure global protein synthesis rates

  • Polysome profiling: To assess translation efficiency

  • Ribosome profiling: For genome-wide analysis of translation

  • Translation reporter assays: Using luciferase or fluorescent protein-based reporters

What is the potential role of SEC61B in disease pathogenesis beyond diabetes?

While the strongest evidence links SEC61B to diabetes-associated platelet dysfunction, emerging research suggests potential roles in other pathological conditions:

  • Cancer relevance: While SEC61B itself has limited cancer research, the related SEC61G (gamma subunit) shows copy-number changes and overexpression in glioblastoma (47% of cases showed high copy-number gains) .

  • Therapeutic targeting: Natural product modulators of Sec61 function have shown value as chemical probes to interrogate signaling in treatment-resistant human cancers .

  • ER stress-related diseases: Given SEC61B's role in ER stress responses, it may be implicated in diseases characterized by ER dysfunction, including neurodegenerative disorders, inflammatory conditions, and metabolic diseases.

Research approaches to investigate these associations include:

  • Expression analysis in disease tissues: Using proteomics, immunohistochemistry, or transcriptomics

  • Genetic association studies: Examining SEC61B variants in patient populations

  • Combination therapy approaches: As shown with Coibamide A potentiating the cytotoxic efficacy of kinase inhibitors in cancer models

What are the key quality control parameters for recombinant SEC61B protein?

When working with recombinant SEC61B protein, researchers should consider several quality control parameters:

  • Expression system compatibility: Human SEC61B has been successfully expressed in wheat germ expression systems for research applications .

  • Protein size verification: Full-length human SEC61B spans amino acids 1-96, and proper size should be confirmed by SDS-PAGE .

  • Functional validation: Confirmation of proper folding through functional assays such as binding studies or limited proteolysis.

  • Purity assessment: Through analytical techniques such as size-exclusion chromatography or mass spectrometry.

  • Storage considerations: Optimizing buffer conditions and temperature to maintain stability and function.

How can signal peptide features be evaluated in relation to SEC61B-mediated translocation?

SEC61B as part of the SEC61 complex facilitates translocation of polypeptides with amino-terminal signal peptides (SP). Recent proteomics approaches have revealed specific signal peptide features that determine client specificity for translocation machinery components:

  • Proteomics approaches: Quantitative label-free proteomics can be used to analyze cellular protein abundance changes upon depletion of translocation components .

  • SP sequence analysis: Computational approaches to identify sequence features that correlate with SEC61B dependence.

  • In vitro translocation assays: Using reporter proteins with various signal sequences to assess SEC61B contribution.

  • TRAP complex relationship: While the Sec61 complex facilitates translocation of all polypeptides with amino-terminal signal peptides, the TRAP complex supports translocation of only a subset of precursors. Understanding this selectivity can inform SEC61B research .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.