Recombinant Human Protein transport protein Sec61 subunit gamma (SEC61G)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Overview

Recombinant Human SEC61G is a laboratory-produced form of the gamma subunit of the Sec61 translocon complex, essential for co- and post-translational protein translocation into the endoplasmic reticulum (ER) . The native Sec61 complex (Sec61α/β/γ) forms a heterotrimeric channel that facilitates the transport of secretory and membrane proteins into the ER lumen, enabling critical post-translational modifications like glycosylation .

Normal Biological Functions

  • Protein Translocation: Mediates ER entry of nascent polypeptides, enabling glycosylation and folding .

  • Pathway Involvement:

    PathwayRelated Proteins
    Protein exportSEC62, SPCS3, HSPA5
    ER stress responseBiP (HSPA5), PERK, ATF4

Pathological Roles in Cancer

  • Immune Evasion: Stabilizes immune checkpoint ligands (e.g., PD-L1, PVR) via glycosylation, promoting T-cell suppression in glioblastoma (GBM) .

  • Metastasis: Drives metabolic reprogramming in non-small cell lung cancer (NSCLC) by stabilizing PGAM1, enhancing glycolysis, and suppressing CD8+ T-cell infiltration .

  • Prognostic Marker: Overexpression correlates with poor survival in kidney cancer (TCGA data) and GBM .

Experimental Use Cases

  • Mechanistic Studies: SEC61G knockdown in GBM cells reduces PD-L1 membrane localization and enhances CD8+ T-cell cytotoxicity .

  • Therapeutic Targeting: SEC61G inhibition synergizes with EGFR tyrosine kinase inhibitors in EGFR-amplified tumors .

Key Interaction Partners

InteractorFunctionMethod
PD-L1Immune checkpoint ligand stabilizationCo-IP, glycosylation assays
PGAM1Glycolytic enzyme stabilizationUbiquitination assays
UBE3CE3 ligase antagonismCompetitive binding

Clinical and Pharmacological Relevance

  • Cancer Biomarker: High SEC61G expression predicts resistance to chemo/radiotherapy and immune checkpoint blockade .

  • Therapeutic Potential: SEC61 translocon inhibitors (e.g., KZR-261) are under clinical investigation (NCT05047536) to reduce PD-L1 levels and enhance immunotherapy efficacy .

References

  1. Creative BioMart: SEC61G Overview [https://www.creativebiomart.net/symbolsearch_sec61g.htm]

  2. Wikipedia: Sec61 Structure [https://en.wikipedia.org/wiki/Sec61]

  3. IJBS (2025): SEC61G in Brain Metastasis [https://www.ijbs.com/v21p1436.pdf]

  4. Human Protein Atlas: SEC61G Expression [https://www.proteinatlas.org/search/SEC61G]

  5. PNAS (2023): SEC61G-EGFR Axis in GBM [https://www.pnas.org/doi/10.1073/pnas.2303400120]

  6. Wikipedia: SEC61G Gene [https://en.wikipedia.org/wiki/SEC61G]

  7. Nature (2017): Sec Complexes in Disease [https://www.nature.com/articles/sigtrans20172]

  8. Cusabio: Recombinant SEC61G [https://www.cusabio.com/datasheet/12759818/EP/]

  9. PMC (2023): SEC61G in Immune Evasion [https://pmc.ncbi.nlm.nih.gov/articles/PMC10410745/]

  10. Spandidos (2021): SEC61G in Kidney Cancer [https://www.spandidos-publications.com/10.3892/mmr.2021.12066]

  11. Spandidos (2022): SEC61G in Lung Adenocarcinoma [https://www.spandidos-publications.com/10.3892/ol.2022.13316]

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SEC61G; Protein transport protein Sec61 subunit gamma
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-68
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG
Uniprot No.

Target Background

Function
Sec61 subunit gamma (SEC61G) is a component of the SEC61 channel-forming translocon complex, mediating the transport of signal peptide-containing precursor polypeptides across the endoplasmic reticulum (ER) membrane. It is part of a ribosome-associated ER translocon complex involved in multi-pass membrane protein transport into the ER and biogenesis. The SEC61 channel collaborates with the translocating protein TRAM1 to import nascent proteins into the ER.
Gene References Into Functions
  1. Sequencing of childhood ependymoma samples revealed SEC61G-epidermal growth factor receptor (EGFR) chimeric mRNAs in one infratentorial ependymoma, suggesting this fusion occurs in a small subset of these tumors. PMID: 29092923
  2. Cotransin, a substrate-selective Sec61 inhibitor, traps nascent transmembrane domains in the cytosolic vestibule, enabling detailed analysis of an early pre-integration intermediate. PMID: 24497544
Database Links

HGNC: 18277

OMIM: 609215

KEGG: hsa:23480

STRING: 9606.ENSP00000341538

UniGene: Hs.488282

Protein Families
SecE/SEC61-gamma family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is SEC61G and what is its role in cellular biology?

SEC61G is a gamma subunit of the SEC61 complex, which also contains alpha (SEC61A) and beta (SEC61B) subunits. This complex serves as the central component of the protein translocation apparatus on the endoplasmic reticulum (ER) membrane . The SEC61G gene maps to chromosome 7p11.2 and encodes a 68-amino acid single-pass membrane protein with a calculated and observed molecular weight of 7.7 kDa . Functionally, SEC61G is essential for the translocation of newly synthesized proteins into the ER, where they undergo folding, modification, and quality control before further trafficking within the cell . This process is fundamental for proper protein maturation and cellular homeostasis.

How does SEC61G contribute to protein processing in the ER?

SEC61G, as part of the SEC61 translocon complex, facilitates the entry of newly translated proteins into the ER lumen or membrane. The process begins when signal recognition particles (SRPs) identify signal sequences on nascent polypeptides and direct ribosomes to the ER membrane. The SEC61 complex then forms a channel through which proteins can be translocated . Research has demonstrated that SEC61G specifically assists in the translocation of certain proteins, including immune checkpoint ligands (ICLs) such as PD-L1, PVR, and PD-L2, promoting their glycosylation, stabilization, and eventual membrane presentation . Additionally, the complex participates in the unfolded protein response (UPR), which helps cells manage ER stress under conditions of hypoxia and nutrient deprivation commonly found in tumor microenvironments .

What are the distinguishing features of SEC61G compared to other SEC61 subunits?

While SEC61A and SEC61B have been extensively studied, SEC61G has distinctive characteristics. It is the smallest of the three subunits at only 7.7 kDa . Unlike mutations in SEC61A1, which have been linked to autosomal dominant polycystic liver disease (ADPLD) , SEC61G alterations are more frequently associated with cancer, particularly through gene amplification rather than mutation . Research indicates that while all three subunits are necessary for the complete functioning of the SEC61 complex, SEC61G may have unique roles in certain cellular contexts, especially in cancer cells where it is frequently overexpressed .

What is the relationship between SEC61G and EGFR in glioblastoma?

SEC61G has been identified as a gene frequently coamplified with EGFR in glioblastoma (GBM) due to their proximity on chromosome 7p11 . This coamplification is significant because EGFR amplification occurs in 50-60% of primary GBM tumors, and clinical trials targeting EGFR alone have shown limited efficacy . Research has revealed that SEC61G may contribute to this therapeutic resistance by promoting immune evasion mechanisms. Specifically, SEC61G facilitates the processing and membrane presentation of immune checkpoint ligands (ICLs), which help cancer cells evade immune surveillance . This relationship suggests that targeting both EGFR and SEC61G could provide a more effective therapeutic strategy for GBM patients with 7p11 amplification.

How does SEC61G contribute to tumor immune evasion mechanisms?

SEC61G plays a crucial role in cancer immune evasion by facilitating the processing of immune checkpoint ligands (ICLs). As demonstrated in GBM studies, SEC61G promotes the translocation of newly synthesized ICLs such as PD-L1, PVR, and PD-L2 into the ER . This translocation is essential for proper glycosylation and stabilization of these proteins. When SEC61G is depleted, there is a significant decrease in the glycosylated forms of these ICLs and a corresponding increase in their non-glycosylated forms . This results in reduced membrane presentation of these immune inhibitory molecules, allowing for enhanced immune cell recognition and attack of tumor cells. Experiments have shown that SEC61G depletion promotes the infiltration and cytolytic activity of CD8+ T cells, inhibiting GBM growth .

What evidence supports SEC61G's role in breast cancer progression?

Research has established that SEC61G is involved in breast cancer development and metastasis through metabolic regulation. Gene expression analysis of breast cancer data from The Cancer Genome Atlas (TCGA) has revealed a positive correlation between SEC61G expression and glycolysis-related genes . This was confirmed by Gene Ontology (GO) enrichment analysis, Kyoto Encyclopedia of Gene and Genomes (KEGG) signaling pathway analysis, and Gene Set Enrichment Analysis (GSEA), all indicating that high SEC61G expression is associated with enhanced glycolysis in breast cancer cells . Functionally, overexpression of SEC61G leads to increased glucose consumption, lactate production, and ATP levels, while knockdown produces the opposite effects . Additionally, SEC61G expression positively correlates with Ki-67 expression, a marker of cell proliferation, suggesting that upregulated SEC61G may contribute to increased cancer cell proliferation rates.

What are the recommended techniques for detecting SEC61G protein expression in tissue samples?

When investigating SEC61G expression in tissue samples, several techniques have proven effective. Immunohistochemistry (IHC) can be performed using specific antibodies (such as 11147-2-AP) at dilutions between 1:20-1:200, with antigen retrieval using TE buffer at pH 9.0 or alternatively with citrate buffer at pH 6.0 . For optimal results in human samples, such as colon cancer tissue, titration is recommended to determine the ideal antibody concentration for specific tissue types. Western blotting provides quantitative assessment of SEC61G levels, with recommended antibody dilutions of 1:500-1:1000 . Additional techniques like immunofluorescence (IF) can be used to examine subcellular localization, particularly co-localization with ER markers such as GRP94 to confirm proper localization and function . For analyzing glycosylated versus non-glycosylated forms of proteins affected by SEC61G, both Western blotting and flow cytometry have been successfully employed .

How can researchers effectively modulate SEC61G expression in experimental models?

To study SEC61G function, researchers have employed various approaches to modulate its expression. For knockdown experiments, siRNA and shRNA targeting SEC61G have been successfully used in multiple cell lines, including GBM and breast cancer cells . When designing knockdown constructs, researchers should target conserved regions of SEC61G mRNA while avoiding regions with significant homology to other SEC61 family members. For overexpression studies, transfection of expression vectors containing the SEC61G coding sequence is effective, typically using CMV promoters for strong expression . For more stable expression, lentiviral or retroviral transduction systems have been employed. To assess the effects of SEC61G modulation on specific pathways, researchers should include appropriate controls and examine changes in protein glycosylation, ER translocation, membrane protein presentation, and downstream cellular processes such as glycolysis . CRISPR-Cas9 gene editing has also been used for complete knockout studies, though this may affect cell viability in some contexts given SEC61G's essential function.

What cellular assays are most informative for studying SEC61G's impact on protein trafficking?

Several specialized assays can effectively measure SEC61G's role in protein trafficking and processing. Pulse-chase experiments using radiolabeled amino acids help track the progression of newly synthesized proteins through the secretory pathway, revealing how SEC61G affects translocation rates. Co-immunoprecipitation assays can identify SEC61G's interactions with client proteins and other translocon components . For studying glycoprotein processing, enzymatic deglycosylation assays using PNGase F or Endo H treatment followed by Western blotting can distinguish between glycosylated and non-glycosylated forms of proteins like PD-L1, revealing SEC61G's impact on protein maturation . Subcellular fractionation followed by Western blotting for specific proteins allows quantification of protein distribution between ER, Golgi, and plasma membrane compartments. Additionally, live-cell imaging using fluorescently tagged proteins can visualize trafficking dynamics in real-time, while reporter assays with secreted luciferase or alkaline phosphatase can quantitatively measure the efficiency of protein secretion in SEC61G-modulated cells.

How does SEC61G selectivity influence the processing of different client proteins?

Recent research has begun to uncover the selective influence of SEC61G on different client proteins. While SEC61G facilitates the translocation of many proteins, it appears to have preferential effects on certain classes of proteins, including immune checkpoint ligands and potentially glycolytic enzymes . This selectivity raises important questions about the structural determinants that govern SEC61G-client interactions. Advanced approaches to address this question include comparative proteomics of SEC61G-depleted versus control cells, focusing on changes in the glycoproteome, secretome, and membrane proteome. Researchers should employ stable isotope labeling with amino acids in cell culture (SILAC) or tandem mass tag (TMT) labeling followed by mass spectrometry to quantitatively assess changes across multiple protein classes. Additionally, structural studies using cryo-electron microscopy of the SEC61 complex with different client proteins can reveal interaction interfaces. Combining these approaches with site-directed mutagenesis of both SEC61G and potential client proteins will help identify critical residues governing selectivity and efficiency of translocation, advancing our understanding of how SEC61G contributes to cancer-specific protein processing.

What is the interplay between SEC61G and the unfolded protein response in cancer cells?

The relationship between SEC61G and the unfolded protein response (UPR) represents an emerging area of research importance. SEC61G's role in protein translocation at the ER directly intersects with UPR activation, which occurs when misfolded proteins accumulate in the ER . Cancer cells, particularly in hypoxic tumor microenvironments, often exhibit chronic UPR activation as an adaptive mechanism. To investigate this relationship, researchers should measure UPR sensor activation (IRE1α, PERK, and ATF6) in models with SEC61G modulation, focusing on phosphorylation status, downstream target activation, and XBP1 splicing. RNA sequencing of SEC61G-depleted cancer cells can reveal changes in UPR-related gene expression programs. Additionally, researchers should examine how SEC61G knockdown or overexpression affects cancer cell survival under ER stress conditions induced by agents like tunicamycin, thapsigargin, or physiological stressors like hypoxia and nutrient deprivation. Particularly relevant is whether SEC61G depletion sensitizes cancer cells to ER stress-inducing therapies, which could provide a mechanistic basis for novel combination treatments targeting both SEC61G and the UPR pathway in cancers with SEC61G overexpression.

How does post-translational modification of SEC61G regulate its function in different cellular contexts?

The regulation of SEC61G through post-translational modifications (PTMs) remains largely unexplored but potentially significant for understanding its context-specific functions. Given SEC61G's small size (68 amino acids) , even minor modifications could substantially impact its function, stability, or interactions. To comprehensively characterize SEC61G PTMs, researchers should employ mass spectrometry-based proteomics on immunoprecipitated SEC61G from various cell types and conditions, including normal versus cancer cells and different stress conditions. Potential modifications to investigate include phosphorylation, ubiquitination, SUMOylation, and acetylation. Site-directed mutagenesis of identified modification sites followed by functional assays for protein translocation efficiency can determine the impact of specific PTMs. Additionally, researchers should identify the enzymes responsible for these modifications and examine their expression patterns across cancer types. Particularly important is understanding whether cancer-specific signaling pathways, such as those downstream of EGFR in GBM, directly modify SEC61G function through PTMs, potentially explaining the synergistic effects observed between SEC61G and EGFR in cancer progression .

How might SEC61G inhibition complement existing cancer therapies?

SEC61G inhibition has demonstrated promising potential as a complementary approach to existing cancer therapies, particularly in EGFR-amplified glioblastoma . Research has shown that SEC61G depletion significantly enhances the therapeutic efficacy of EGFR tyrosine kinase inhibitors in mouse models, suggesting a synergistic effect . This synergy likely stems from SEC61G's role in immune evasion, where it promotes the processing and presentation of immune checkpoint ligands like PD-L1 . When SEC61G is inhibited, these ligands show reduced glycosylation and membrane presentation, leading to increased immune cell infiltration and cytolytic activity against tumor cells . To develop effective combination therapies, researchers should conduct comprehensive preclinical studies examining SEC61G inhibition in combination with various treatment modalities, including:

Therapeutic ApproachPotential Synergy Mechanism with SEC61G InhibitionRecommended Experimental Models
EGFR inhibitorsSimultaneous targeting of proliferation and immune evasionPatient-derived xenografts with EGFR amplification
Immune checkpoint inhibitorsEnhanced efficacy through increased target recognitionSyngeneic mouse models with intact immune systems
Radiation therapyIncreased immunogenic cell death and antigen presentationOrthotopic GBM models with fractionated radiation
Standard chemotherapyImproved immune surveillance of damaged cellsBoth in vitro spheroid models and in vivo xenografts

These studies should assess not only tumor growth but also immune infiltration, cytokine profiles, and long-term survival outcomes .

What are the potential mechanisms for developing direct inhibitors of SEC61G function?

  • High-resolution structural studies of the SEC61 complex using cryo-electron microscopy to identify potential binding pockets

  • Protein-protein interaction assays to map critical binding surfaces between SEC61G and its partners

  • Fragment-based screening to identify initial chemical matter with binding affinity for SEC61G

  • Targeted protein degradation approaches (PROTACs) specifically designed for SEC61G

Inhibitor ApproachAdvantagesChallengesExperimental Validation Methods
Small molecule inhibitorsTraditional drug-like propertiesSmall size of SEC61G limits binding sitesCellular protein translocation assays
PeptidomimeticsCan disrupt specific protein-protein interfacesPoor cell permeabilityCo-immunoprecipitation assays
Antisense oligonucleotidesHigh specificity for SEC61GDelivery to target tissuesqPCR and Western blot confirmation
PROTACsCan achieve complete protein eliminationComplex bifunctional molecule designProteasome-dependent degradation assays

Researchers should prioritize assessing both on-target efficacy and potential toxicity, as complete inhibition of SEC61G might affect normal cellular functions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.