Recombinant Human Protein tweety homolog 1 (TTYH1)

Shipped with Ice Packs
In Stock

Description

Introduction to TTYH1

TTYH1 (Tweety Homolog 1) is a calcium-independent chloride channel belonging to the Tweety homolog family. It is a five-transmembrane domain protein expressed predominantly in neural tissues, including the brain, eye, ovary, and testis . In humans, TTYH1 is encoded by the TTYH1 gene located on chromosome 19q13.42 and plays critical roles in cell volume regulation, membrane remodeling, and stem cell maintenance .

Functional Roles

  • Volume Regulation: Mediates regulatory volume decrease (RVD) via chloride efflux in response to osmotic stress .

  • Membrane Remodeling: Induces extracellular vesicle (EV) formation and tubulation, similar to prominin-1 (PROM1) .

  • Stem Cell Quiescence: Maintains neural stem cell (NSC) dormancy via Ca²⁺/NFATc3 signaling .

Tissue and Cellular Distribution

Tissue/Cell TypeExpression LevelKey FunctionsSource
BrainHighNeurogenesis, NSC quiescence
EyeModerateMembrane remodeling in photoreceptors
Ovary/TestisModerateReproductive cell volume regulation
Glioma CellsOverexpressedTumor progression, invasion

In NSCs, TTYH1 is enriched in the apical ventricular zone, where it regulates the quiescence-activation balance .

Production Systems and Tags

ParameterDetailsSource
Host SystemsE. coli, Mammalian cells (HEK293)
TagsHis-tag (N-terminal)
Purity>90% (SDS-PAGE validated)
Applications- Antibody development
- Structural studies
- Functional assays

Recombinant TTYH1 fragments (e.g., extracellular domains or C-terminal regions) are used to generate monoclonal antibodies for immunofluorescence and Western blotting .

Role in Neural Stem Cells

  • Quiescence Maintenance: TTYH1 knockout in mice accelerates NSC activation, depleting the stem cell pool in aging .

  • Ca²⁺/NFATc3 Signaling: TTYH1 suppresses calcium influx, inhibiting NFATc3 activation and cell cycle entry .

Membrane Dynamics

  • EV Formation: TTYH1 induces tubulated EVs with higher protein density than PROM1, suggesting molecular crowding as a bending mechanism .

  • Cholesterol Interaction: TTYH1 binds cholesterol less stably than PROM1, promoting membrane flexibility .

Cancer and Pathology

  • Tumor Progression: Overexpression in gliomas correlates with invasion and proliferation .

  • Retinal Pathology: Structural similarities to PROM1 suggest potential roles in photoreceptor membrane maintenance .

Therapeutic Potential and Challenges

Therapeutic TargetPotential ApplicationsChallengesSource
NeurogenesisEnhancing NSC activation for repairUncontrolled activation may impair
Cancer TherapyInhibiting invasion in gliomasOff-target effects in neural tissue
Retinal DiseasesMimicking PROM1 function in dystrophyLimited human data

While TTYH1 presents therapeutic opportunities, its role in both normal physiology and pathology necessitates precise targeting strategies.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
TTYH1; Protein tweety homolog 1; hTTY1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-450
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TTYH1
Target Protein Sequence
MGAPPGYRPSAWVHLLHQLPRADFQLRPVPSVFAPQEQEYQQALLLVAALAGLGLGLSLI FIAVYLIRFCCCRPPEPPGSKIPSPGGGCVTWSCIVALLAGCTGIGIGFYGNSETSDGVS QLSSALLHANHTLSTIDHLVLETVERLGEAVRTELTTLEEVLEPRTELVAAARGARRQAE AAAQQLQGLAFWQGVPLSPLQVAENVSFVEEYRWLAYVLLLLLELLVCLFTLLGLAKQSK WLVIVMTVMSLLVLVLSWGSMGLEAATAVGLSDFCSNPDPYVLNLTQEETGLSSDILSYY LLCNRAVSNPFQQRLTLSQRALANIHSQLLGLEREAVPQFPSAQKPLLSLEETLNVTEGN FHQLVALLHCRSLHKDYGAALRGLCEDALEGLLFLLLFSLLSAGALATALCSLPRAWALF PPSDDYDDTDDDDPFNPQESKRFVQWQSSI
Uniprot No.

Target Background

Function
This protein is likely a chloride channel. It may play a role in cell adhesion. Isoform 3 may be a Ca(2+)-independent and swelling-activated chloride channel, potentially involved in regulating cell volume.
Gene References Into Functions
  1. This report identifies tweety-homolog 1 (TTYH1), a membrane protein associated with neuronal development, as a potent driver of tumor microtube (TM)-mediated brain colonization by glioma cells. PMID: 28607172
  2. TTYH1 expression was not detected in either the malignant or the control samples. PMID: 25182704
  3. Fusion of TTYH1 with the C19MC microRNA cluster drives expression of a brain-specific DNMT3B isoform in the embryonal brain tumor. PMID: 24316981
  4. Nedd4-2 differentially interacts with and regulates TTYH1-3. PMID: 18577513
Database Links

HGNC: 13476

OMIM: 605784

KEGG: hsa:57348

UniGene: Hs.268728

Protein Families
Tweety family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in brain, eye, ovary and testis, and at lower levels in muscle, placenta, liver and lung.

Q&A

What is the structural architecture of TTYH1 and how does it compare to other Tweety homolog family members?

TTYH1 is part of the conserved Tweety homolog family, which includes three human paralogs (TTYH1-3). Cryo-electron microscopy has revealed that TTYH1 forms dimers in the membrane with five transmembrane segments and an extended extracellular domain . The protein contains a hydrophobic pocket in its extracellular domain that emerges from the lipid bilayer, suggesting potential interactions with lipid-like compounds .

All three TTYH paralogs display similar structural features as dimeric membrane proteins, though they show differences in expression patterns: TTYH1 and TTYH2 are primarily expressed in brain, spinal cord, and testis, while TTYH3 exhibits broader expression across tissues . Conformational differences between paralogs lead to variations in transmembrane interactions, with TTYH1 and TTYH3 showing increased contact areas between interacting subunits of approximately 2600 and 3655 Ų, respectively .

How does TTYH1 function in membrane dynamics compared to similar proteins?

TTYH1 plays a significant role in plasma membrane tubulation and extracellular vesicle (EV) formation. When overexpressed at the plasma membrane, TTYH1 induces membrane bending and tubulation . Comparative studies with Prominin 1 (Prom1), another membrane-bending protein, have revealed that TTYH1 generates EVs with more tubulated membranes .

Key differences in membrane dynamics include:

  • TTYH1 is present at approximately fivefold higher concentration in EV membranes compared to Prom1

  • TTYH1 produces approximately 5.6-fold more total EV membrane than Prom1 when expressed at equivalent levels

  • TTYH1 EVs demonstrate a higher frequency of membrane bending than Prom1 EVs

  • Distinct density profiles in sucrose gradient sedimentation: Prom1 EVs show a single population, while TTYH1 EVs resolve into two distinct populations with different densities

The Tweety Homology protein family has been hypothesized to be distantly related to prominins, sharing the five-transmembrane topology but with a more minimal extracellular domain .

How does TTYH1 regulate neural stem cell quiescence and activation?

TTYH1 plays a critical role in maintaining the quiescent state of neural stem cells (NSCs). Single-cell sequencing analyses have shown that TTYH1 is specifically expressed in Ki67-negative quiescent NSCs (qNSCs) and downregulated as NSCs become activated . The expression pattern shows:

  • High expression in quiescent NSCs

  • Decreased expression in early activated NSCs

  • Gradual disappearance in middle and late activated NSCs

TTYH1 is involved in calcium signaling in NSCs, with the transcription factor NFATc3 serving as a critical effector in the quiescence versus activation decision . Functional studies demonstrate that TTYH1 knockdown in cultured NSCs leads to adherent growth and neurite protrusion, indicating a shift from the quiescent state toward differentiation .

What are the phenotypic effects of TTYH1 knockout on neurogenesis and behavior?

TTYH1 knockout studies in mice have revealed significant effects on neurogenesis and cognitive behavior:

  • Neurogenic effects:

    • Decreased GFAP+/Sox2+ type-B NSCs in the subventricular zone (SVZ)

    • Increased EGFR+ cells, indicating accelerated differentiation from type-B NSCs into transit-amplifying progenitors

    • Enhanced neuroblast production

    • No significant changes in GFAP+/Sox2+ cells in the subgranular zone (SGZ), suggesting region-specific effects

  • Behavioral outcomes:

    • Enhanced spatial learning and memory in Morris water maze tests:

      • Significantly shorter latency in platform searching (P = 0.0362)

      • Significantly longer time spent in the target area (P = 0.0071)

    • Reduced anxiety-like behavior in open field tests:

      • Increased total travel distance

      • Longer time spent in the central area

These findings suggest that TTYH1 ablation leads to increased activation of quiescent NSCs, enhanced neurogenesis, and improved cognitive performance, consistent with previous research showing that enhanced neurogenesis can improve adaptation to new environments and reduce anxiety .

What are the recommended approaches for generating TTYH1 knockout and reporter models?

Several strategies have been successfully employed to generate and validate TTYH1 knockout and reporter models:

  • CRISPR/Cas9 knockout mice:

    • Delete critical exons (e.g., exon 4), resulting in a truncated protein of 198 amino acids (140 native amino acids plus 58 frame-shift amino acids)

    • Validation through PCR genotyping and immunofluorescence

  • Ttyh1-CreERT2 reporter mice:

    • Use CRISPR/Cas9 to knock in P2A-iCreERT2 at exon 13 while preserving the open reading frame

    • Cross with reporter strains like Ai9 flox-stop-flox-mT mice to create Ttyh1-CreERT2; Rosa-tdTomato mice for lineage tracing and expression studies

  • shRNA-mediated knockdown:

    • For in vitro studies, transfect NSCs with lentivirus expressing shTtyh1

    • Validate through qRT-PCR, Western blotting, and assessment of morphological changes (neurosphere formation versus adherent growth)

  • Functional validation:

    • Assess neurosphere formation capacity

    • Analyze expression of stem cell markers (Sox2, Nestin)

    • Evaluate differentiation marker expression (β-III-tubulin, GFAP)

    • Conduct behavioral testing (Morris water maze, open field tests)

What techniques are effective for analyzing TTYH1-induced extracellular vesicle formation?

TTYH1-induced extracellular vesicle (EV) formation can be analyzed through several complementary techniques:

  • EV isolation:

    • Transfect mammalian cell lines (e.g., Expi293 cells) with TTYH1 expression constructs

    • Purify EVs from conditioned media through differential ultracentrifugation

    • Further purify through sucrose gradient sedimentation

  • Density profile analysis:

    • Subject purified EVs to equilibrium sucrose gradient sedimentation

    • Analyze fraction distribution (TTYH1 EVs resolve into two distinct populations with different densities)

  • Membrane morphology assessment:

    • Electron microscopy to visualize EV membrane structure

    • Quantify membrane tubulation frequency and extent

  • Protein-to-membrane ratio analysis:

    • Compare relative amounts of TTYH1 protein to total EV membrane

    • TTYH1 is present at approximately 5-fold higher concentration in EV membranes compared to Prom1

  • Cholesterol interaction assays:

    • Cholesterol co-immunopurification (chol-IP) using fluorophore-labeled cholesterol

    • Immunoprecipitate with Strep resin and quantify through fluorescence microscopy

These approaches provide comprehensive characterization of TTYH1's membrane-remodeling properties and EV characteristics.

How does TTYH1 interact with membrane cholesterol and how does this affect its function?

TTYH1 interacts with membrane cholesterol, though less stably than Prominin 1. This interaction has been studied using cholesterol co-immunopurification (chol-IP) assays with fluorescent cholesterol . Key findings include:

  • Prom1 forms a more stable interaction with cholesterol than Ttyh1

  • When depleted of cholesterol, Prom1 EVs mimic the tubulation observed in Ttyh1 EVs, suggesting cholesterol interaction modulates membrane-bending activity

  • The more dynamic interaction between TTYH1 and cholesterol may contribute to its enhanced membrane-bending properties

  • The hydrophobic pocket in TTYH1's extracellular domain may be involved in these lipid interactions

This differential cholesterol binding appears to be a key mechanism distinguishing the membrane-remodeling functions of TTYH1 and Prominin 1. The more stable cholesterol binding by Prom1 may inhibit membrane bending, while TTYH1's more dynamic interaction may facilitate tubulation .

How does TTYH1 affect calcium signaling in neural stem cells?

TTYH1 has been implicated in calcium signaling pathways in neural stem cells. Research indicates that:

  • TTYH1 is involved in the regulation of calcium signaling in NSCs

  • The transcription factor NFATc3 acts as a critical downstream effector in determining quiescence versus activation states

While initially proposed to function as a calcium-activated anion channel, recent structural and functional studies have not found evidence supporting ion conduction activity . Instead, TTYH1 appears to function through membrane remodeling and potential interactions with lipid-like compounds residing in the membrane .

The exact mechanisms linking TTYH1's membrane-bending activity to calcium signaling and NSC quiescence regulation require further investigation to fully elucidate. RNA-sequencing studies of TTYH1 knockout models have been conducted to clarify specific molecular pathways involved .

What are the critical quality control measures for recombinant TTYH1 production?

Generating functional recombinant TTYH1 requires several quality control measures:

  • Expression system selection:

    • Mammalian expression systems (like Expi293) are preferred due to TTYH1's complex membrane topology and glycosylation requirements

    • Cryo-EM studies have identified four glycosyl moieties visible in the density of related TTYH2

  • Protein folding verification:

    • TTYH1 naturally forms dimers, so oligomeric state should be verified

    • Detergent selection is critical, with gentle detergents like GDN (glyco-diosgenin) being successfully used in structural studies

  • Functional validation:

    • Given that TTYH1 does not appear to function as an ion channel as previously thought, functional validation requires assays for membrane remodeling

    • EV production in transfected cells provides a functional readout of activity

  • Structural integrity:

    • Secondary structure analysis through circular dichroism

    • Thermal stability assays to ensure proper folding

    • For structural studies, proper model building and refinement protocols are essential

  • Post-translational modification assessment:

    • Verification of glycosylation status at predicted sites

    • Mass spectrometry to confirm protein identity and modifications

What controls should be included in TTYH1 functional experiments?

Appropriate controls are essential for robust TTYH1 experiments:

  • Expression controls:

    • Empty vector controls for transfection experiments

    • Scrambled/non-targeting shRNA controls for knockdown studies

    • Wild-type littermate controls for knockout animal studies

  • Functional comparison controls:

    • Prominin 1 (Prom1) serves as a valuable comparison for EV formation and membrane-bending studies

    • Co-expression experiments of TTYH1 with Prom1 can reveal functional interactions

  • Specificity controls:

    • Multiple independent shRNAs targeting different regions of TTYH1 to control for off-target effects

    • Rescue experiments with shRNA-resistant TTYH1 constructs

  • Biochemical controls:

    • For cholesterol binding studies, include proteins known not to bind cholesterol

    • For sucrose gradient analyses, include marker proteins of known sedimentation properties

  • Quantification standards:

    • Internal standards for Western blot quantification

    • Fluorescent protein tags (like mTagBFP2) as normalizing controls for imaging-based quantification

These controls help ensure that observed effects are specifically attributable to TTYH1 and facilitate accurate interpretation of experimental results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.