Recombinant Human Protein unc-50 homolog (UNC50)

Shipped with Ice Packs
In Stock

Description

Table 1: Recombinant UNC50 Variants and Production Systems

Source HostTagPurityApplicationsCatalog Number
HEK293T CellsC-Myc/DDK>80%WB, ELISAPROTQ53HI1
Wheat GermGST (N-Term)>80%ELISA, Western BlotH00025972-P01
E. coliHis Tag>90%Affinity PurificationRFL18156HF
Tobacco (CFPS)Strep Tag>70%SDS-PAGE, WBABIN3100670

EGFR Pathway Activation in HCC

UNC50 overexpression in HCC tissues correlates with enhanced cell proliferation via ligand-dependent EGFR signaling :

  • Mechanism: Facilitates EGFR translocation to the cell surface, increasing receptor availability for epidermal growth factor (EGF) .

  • Key Findings:

    • 45.5% of HCC samples showed UNC50 upregulation .

    • Phospho-EGFR (Tyr1068) levels increased with UNC50 expression in serum-stimulated conditions .

Subcellular Localization

  • Localizes to the Golgi apparatus and inner nuclear membrane, implicating roles in protein trafficking and RNA binding .

  • Triton X-100-resistant nuclear membrane association suggests structural integration .

Research Applications

Recombinant UNC50 is utilized in:

  • Cancer Research: Studying EGFR-driven proliferation in HCC .

  • Protein Trafficking Studies: Investigating Golgi apparatus functions .

  • Biochemical Assays: ELISA, Western blotting, and affinity purification .

Table 2: Key Research Findings

Study FocusMethodologyOutcomeReference
HCC ProliferationqPCR, Western BlotUNC50 upregulation in 45.5% of HCC cases
EGFR TraffickingImmunofluorescenceEnhanced EGFR surface localization
Nuclear LocalizationSubcellular ImagingInner nuclear membrane association

Future Directions

  • Therapeutic Targeting: UNC50’s role in HCC suggests potential as a biomarker or drug target .

  • Mechanistic Studies: Further exploration of its RNA-binding functions and interactions with other trafficking proteins .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
UNC50; UNCL; HSD-23; HSD23; Protein unc-50 homolog; Periodontal ligament-specific protein 22; PDLs22; Protein GMH1 homolog; hGMH1; Uncoordinated-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-259
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
UNC50
Target Protein Sequence
MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVLI DCVGVGLLIATLMWFISNKYLVKRQSRDYDVEWGYAFDVHLNAFYPLLVILHFIQLFFIN HVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYGLSL ALGWNFTHTLCSFYKYRVK
Uniprot No.

Target Background

Function
UNC50 is involved in cell surface expression of neuronal nicotinic receptors and exhibits RNA-binding capabilities.
Gene References Into Functions
  1. Biallelic UNC50 gene mutations cause autosomal recessive congenital myasthenic syndrome (AMC) likely through loss of AChR expression at the neuromuscular junction, crucial for cholinergic transmission during muscle development. PMID: 29016857
  2. UNC50 depletion inhibits early endosome-to-Golgi trafficking and promotes lysosomal degradation of Shiga toxin 2 (Stx2) by recruiting the ARF-GEF GBF1 to the Golgi. PMID: 28883040
  3. UNC50 may contribute to hepatocellular carcinoma (HCC) progression through modulation of the EGFR pathway. PMID: 25738771
  4. UNC50 plays a critical role in the development, differentiation, and maintenance of periodontal tissues and in mechanotransduction within periodontal ligament fibroblasts. PMID: 17004066
Database Links

HGNC: 16046

OMIM: 617826

KEGG: hsa:25972

STRING: 9606.ENSP00000350409

UniGene: Hs.13370

Protein Families
Unc-50 family
Subcellular Location
Nucleus inner membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Present in periodontal ligament fibroblasts (at protein level).

Q&A

What is UNC50 and what is its evolutionary origin?

UNC50 was first identified as a mammalian homologue of the Caenorhabditis elegans gene unc-50. The 777 kb rat UNCL cDNA encodes a 259 amino acid protein that is expressed in various tissues, with highest mRNA levels found in brain, kidney, and testis . UNC50 is highly conserved among eukaryotic organisms, suggesting it plays fundamental cellular roles . The conservation pattern indicates its function predates the evolution of specialized receptors like EGFR and nicotinic acetylcholine receptors (AChRs), which are affected by UNC50 in mammals and C. elegans, respectively .

How is UNC50 expressed in human tissues and is it differentially regulated in disease states?

UNC50 is widely expressed across human tissues with varying abundance. Northern blotting and real-time PCR analyses demonstrate that UNC50 is significantly upregulated in hepatocellular carcinoma (HCC) tissues compared to adjacent non-cancerous tissues . In a study of 44 paired HCC samples, 45.5% showed significant UNC50 upregulation, 50% showed no alteration, and only 4.5% showed reduced UNC50 expression . Western blotting confirmed this pattern, with UNC50 detectable in eleven of 12 cancer tissues but only six of 12 non-cancerous tissues . Meta-analysis of 16 independent microarray experiments from the Gene Expression Omnibus database further supported significant upregulation of UNC50 in HCC tissues (p = 0.005) .

What are effective approaches for modulating UNC50 expression in experimental systems?

RNA Interference (RNAi):
Small hairpin RNA (shRNA) constructs targeting UNC50 have been successfully used to generate knockdown cell lines. For example, pLKO.1-shRNA-UNC50-554 (shR-554) and pLKO.1-shRNA-UNC50 (shR-749) containing 21-nucleotide target UNC50 shRNA sequences cloned into pLKO.1 plasmids effectively reduced UNC50 expression in Hep3B cells . Successful knockdown should be confirmed by both RNA and protein analysis.

CRISPR-Cas9 Gene Editing:
CRISPR-Cas9 has been used to generate ΔUNC50 cell lines, as demonstrated in HeLa cells . Sequencing of genomic DNA revealed that in one ΔUNC50 cell line, stop codons were introduced in or immediately after the region coding for the second transmembrane domain, effectively terminating transcription . RT-PCR can confirm successful editing by demonstrating amplification of sequences upstream but not downstream of the introduced stop codons .

Overexpression Systems:
For overexpression studies, the full-length open reading frame of UNC50 can be cloned into expression vectors such as pcDNA3.1-B(-) . Both CRISPR-sensitive and CRISPR-resistant versions can be created, with the latter serving as important controls in gene editing experiments .

What methods are recommended for detecting UNC50 expression and localization?

RNA Detection Methods:

  • Northern blotting using α-32P-UTP-labeled riboprobes specific to UNC50

  • Real-time PCR with primers specific to UNC50, normalized to β-actin

  • RNA-seq for transcriptome-wide analysis of UNC50 and affected genes

Protein Detection Methods:

  • Western blotting with commercially available antibodies (though specificity varies)

  • Epitope tagging (e.g., hemagglutinin or myc) for detection when antibodies are unavailable

  • Immunofluorescence microscopy for localization studies

Localization Studies:

  • Differential extraction protocols (e.g., Triton X-100 resistance for nuclear membrane association)

  • Co-localization with organelle markers (e.g., Golgi apparatus marker AKR7A2, endoplasmic reticulum marker calnexin 1, or early endosome marker EEA1)

  • Salt extraction (UNC50-HA is extractable in 350 mM NaCl, suggesting it is not associated with the nuclear matrix)

How can I investigate UNC50's role in receptor trafficking?

Cell Surface Receptor Quantification:
To evaluate UNC50's effect on receptor trafficking to the cell surface, immunofluorescence staining with and without cell membrane permeabilization can be performed, followed by flow cytometry analysis. This approach effectively demonstrated that UNC50 affects cell surface EGFR amounts without changing total cellular EGFR levels .

For example, cells can be:

  • Cultured in serum-free medium for 24 hours to eliminate ligand influence on receptor translocation

  • Stained with fluorescence-labeled receptor antibodies (e.g., EGFR) with or without 0.05% Triton X-100 permeabilization

  • Analyzed by flow cytometry to compare surface vs. total receptor levels

  • Visualized by fluorescence microscopy to observe receptor localization patterns

Functional Assays:
To assess functional consequences of altered receptor trafficking:

  • Cell cycle analysis by flow cytometry following synchronization in G0 phase by serum starvation

  • Proliferation assays (e.g., MTT) with and without receptor ligands (e.g., EGF)

  • Pathway activation assessment by measuring phosphorylation of receptors and downstream targets

How does UNC50 affect the EGFR signaling pathway?

UNC50 enhances the EGFR pathway by facilitating EGFR translocation to the cell surface, particularly in HCC cell lines like Hep3B . This occurs in a ligand-dependent manner, as demonstrated by experiments showing:

  • UNC50 expression levels correlate with EGFR pathway activity (measured by pEGFR-1068 levels) when cells are cultured with serum or EGF, but not in serum-free conditions

  • Total EGFR protein and mRNA levels remain unchanged by UNC50 modulation, indicating post-translational effects

  • UNC50 affects cell surface EGFR amounts without altering total cellular EGFR, suggesting a role in receptor trafficking rather than expression

This mechanism promotes cell cycle entry and proliferation in the presence of EGF, with effects that can be blocked by erlotinib, a specific EGFR inhibitor .

Table 1: Genes Downregulated by UNC50 Knockdown in Hep3B Cells

Gene SymbolGene NameFunctionFold Change
CCND1Cyclin D1G1/S checkpoint regulationDownregulated*
EGFEpidermal Growth FactorEGFR ligandDownregulated*
MMP7Matrix Metalloproteinase-7Extracellular matrix remodelingDownregulated*
AKR1B10Aldose Reductase-like 1Detoxification/metabolismDownregulated*
MUC1Cell Surface-associated Mucin 1Cell surface glycoproteinDownregulated*
GASTGastrinPeptide hormoneDownregulated*

*Significant downregulation confirmed by real-time PCR following UNC50 knockdown

What is UNC50's role in protein trafficking beyond EGFR?

UNC50 appears to function as a global factor in protein trafficking, with differential effects on specific proteins. Evidence for this includes:

  • In C. elegans, UNC50 is involved in nicotinic acetylcholine receptor (AChR) trafficking

  • In yeast, UNC50 functions as a Golgi apparatus protein

  • In mammalian cells, UNC50 affects EGFR trafficking to the cell surface

  • UNC50 acts by recruiting GBF1, an ADP ribosylation factor–guanine nucleotide exchange factor (ARF-GEF), to the Golgi

The hypothesis that "UNC50 plays certain roles for a specific protein (not confined to the receptor), and affects the counterpart of this protein, thus its effects are neutralized" may explain why UNC50 mutations produce only specific phenotypes despite the protein's conservation across all eukaryotes. This suggests UNC50 may have redundant roles in general protein trafficking, with only certain proteins (like levamisole-sensitive AChR in C. elegans or EGFR in human cancer cells) being exclusively dependent on UNC50 function .

How does UNC50 influence cell cycle progression and cancer development?

UNC50 promotes cell cycle entry and proliferation through its effects on the EGFR pathway. When UNC50 is knocked down in Hep3B cells:

  • More cells are arrested in G0/G1 phase following serum stimulation

  • The expression of cyclin D1 (CCND1), a key regulator of the G1/S transition, is reduced

  • Cell proliferation is decreased, particularly when EGF is continuously supplied

These effects are enhanced by EGF stimulation and countered by erlotinib (an EGFR inhibitor), confirming that UNC50's role in cell cycle regulation is mediated through the EGFR pathway .

The upregulation of UNC50 in HCC tissues suggests it may contribute to cancer development by enhancing EGFR signaling, which is known to promote cell proliferation, survival, and metastasis . This makes UNC50 a potential target for cancer therapy, particularly in tumors dependent on EGFR signaling.

What are the challenges in studying UNC50 function and potential contradictions in the literature?

Several challenges and contradictions exist in UNC50 research:

Localization Discrepancies:
Early studies localized UNC50 to the inner nuclear membrane , while later studies identified it as a Golgi apparatus protein . This may reflect:

  • Cell-type specific differences

  • Multiple functional pools of the protein

  • Methodological differences in detection

  • Dynamic localization depending on cellular conditions

Antibody Limitations:
Commercial antibodies for UNC50 have shown variable specificity, complicating protein detection. Many studies resort to epitope tagging (HA, myc, GFP) for reliable detection .

Functional Redundancy:
UNC50 appears to have redundant roles in protein trafficking, making phenotypes subtle or specific to certain contexts. For example, UNC50 mutants in C. elegans show impaired movement but few other phenotypes .

Context-Dependent Effects:
UNC50's effects may vary depending on:

  • Cell type (e.g., cancer vs. normal cells)

  • Growth conditions (e.g., presence of serum or growth factors)

  • Expression levels of interaction partners

  • Developmental stage

What are the current hypotheses regarding UNC50's mechanism of action?

Two main hypotheses exist regarding UNC50's mechanism of action:

Specific Protein Dependency Hypothesis:
UNC50 plays a redundant role in protein trafficking, but certain proteins (like levamisole-sensitive AChR in C. elegans or EGFR in human cancer cells) exclusively rely on UNC50 function . This explains why UNC50 mutations produce specific phenotypes despite the protein's conservation across all eukaryotes.

GBF1 Recruitment Hypothesis:
UNC50 functions by recruiting GBF1, an ARF-GEF, to the Golgi apparatus . This recruitment is essential for proper protein trafficking through the secretory pathway. GBF1 activates ARF GTPases, which regulate vesicle budding and membrane trafficking.

Neutralization Through Counterpart Hypothesis:
"UNC50 plays certain roles for a specific protein (not confined to the receptor), and affects the counterpart of this protein, thus its effects are neutralized" . This could explain why UNC50 appears to have specific rather than global effects despite its evolutionary conservation.

What experimental approaches can address contradictions in UNC50 research?

Comprehensive Localization Studies:

  • Perform super-resolution microscopy with multiple organelle markers across different cell types

  • Use live-cell imaging with fluorescently tagged UNC50 to track dynamic localization

  • Employ subcellular fractionation with quantitative proteomics to identify all UNC50-containing compartments

Interactome Analysis:

  • Perform immunoprecipitation-mass spectrometry in multiple cell types to identify context-specific interaction partners

  • Use proximity labeling approaches (BioID, APEX) to identify neighboring proteins in living cells

  • Validate key interactions with co-immunoprecipitation and functional studies

Systematic Trafficking Studies:

  • Develop high-content screening approaches to examine effects of UNC50 on multiple receptors and cargo proteins

  • Use synchronized trafficking assays (e.g., RUSH system) to measure kinetics of protein transport

  • Employ proteomics approaches to quantify changes in the cell surface proteome following UNC50 modulation

In Vivo Models:

  • Generate tissue-specific UNC50 knockout mice to examine context-dependent phenotypes

  • Use CRISPR-Cas9 to introduce specific mutations identified in human diseases

  • Perform rescue experiments with various UNC50 mutants to dissect structure-function relationships

What are potential therapeutic applications targeting UNC50?

Given UNC50's role in EGFR trafficking and its upregulation in HCC, several therapeutic approaches could be considered:

Direct UNC50 Targeting:

  • Small molecule inhibitors disrupting UNC50-GBF1 interaction

  • Antisense oligonucleotides or siRNAs for UNC50 knockdown in tumors

  • Peptide-based inhibitors of UNC50 transmembrane domains

Combination Therapies:

  • UNC50 inhibition combined with EGFR inhibitors (e.g., erlotinib) may enhance efficacy

  • Targeting UNC50 in tumors resistant to conventional EGFR inhibitors

  • Combining UNC50 targeting with immunotherapy approaches

Biomarker Potential:
UNC50 expression levels could serve as:

  • Diagnostic markers for certain cancer types (particularly HCC)

  • Predictive biomarkers for response to EGFR-targeted therapies

  • Prognostic indicators of cancer aggressiveness

Considerations:

  • The ubiquitous expression and evolutionary conservation of UNC50 suggest potential for off-target effects

  • Cell-type specific differences in UNC50 function may affect therapeutic window

  • Careful validation in multiple preclinical models is essential before clinical translation

What technologies are emerging to better understand UNC50 function?

Single-Cell Approaches:

  • Single-cell RNA-seq to identify cell populations particularly dependent on UNC50

  • Single-cell proteomics to characterize UNC50 protein complexes in rare cell types

  • Spatial transcriptomics to map UNC50 expression patterns in complex tissues

Structural Biology:

  • Cryo-electron microscopy to determine UNC50's membrane protein structure

  • Molecular dynamics simulations to model UNC50 interactions with membranes and partners

  • Hydrogen-deuterium exchange mass spectrometry to map dynamic protein interactions

Genome-Wide Functional Screens:

  • CRISPR activation/interference screens to identify genes that modify UNC50 phenotypes

  • Chemical-genetic screens to find small molecules that affect UNC50 function

  • Synthetic lethality screens to identify context-dependent vulnerabilities

How might multi-omics approaches advance our understanding of UNC50?

An integrated multi-omics approach could resolve contradictions and provide comprehensive insights:

  • Genomics: Identify genetic variants in UNC50 associated with disease risk

  • Transcriptomics: Map UNC50 expression networks across tissues and conditions

  • Proteomics: Characterize the UNC50 interactome and its dynamic changes

  • Metabolomics: Identify metabolic pathways affected by UNC50 dysfunction

  • Glycomics: Examine effects on protein glycosylation and trafficking

  • Spatial omics: Map UNC50 function within specific subcellular compartments

Integration of these datasets could reveal unexpected functions and resolve apparent contradictions in the literature by accounting for context-specific effects.

What are the most promising translational opportunities for UNC50 research?

Cancer Diagnostics and Therapeutics:
Given UNC50's upregulation in HCC and its effect on EGFR trafficking, developing diagnostic tools and targeted therapies for cancers with aberrant UNC50 expression represents a promising direction .

Neurodegenerative Diseases:
UNC50's role in protein trafficking and its high expression in brain tissue suggest potential involvement in neurodegenerative diseases characterized by protein trafficking defects.

Drug Delivery Systems:
Understanding UNC50's role in membrane trafficking could inform the development of novel drug delivery systems targeting specific cellular compartments.

Personalized Medicine: Characterizing individual variations in UNC50 expression or function could help predict response to therapies targeting receptor tyrosine kinases like EGFR.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.