Recombinant Human Protein YIF1B (YIF1B)

Shipped with Ice Packs
In Stock

Description

Intracellular Trafficking

YIF1B regulates ER-to-Golgi anterograde transport and Golgi architecture . It interacts with the 5-HT1A serotonin receptor to mediate its dendritic targeting in neurons .

Key Functional Domains:

DomainRoleEvidence
C-TerminalER export via dileucine motif
α4 HelixInteraction with viral ORF8 β8 sheet
Membrane AnchorsER/Golgi localization

Pathological Relevance

In SARS-CoV-2 infection, YIF1B facilitates unglycosylated ORF8 secretion via unconventional pathways, contributing to cytokine storms . Knockdown of YIF1B reduces inflammation and mortality in hamster models .

Production Methods

VendorHostPurityApplications
AbcamWheat germFull-lengthSDS-PAGE, ELISA, WB
Boster BioE. coli>90%SDS-PAGE, Western Blot
Creative BioMartE. coli>90%SDS-PAGE, Functional Assays

Research Applications

ApplicationDescriptionLimitations
ELISAQuantifies YIF1B in serum/plasmaDetects total protein, not activity
SDS-PAGEValidates purity and sizeDenatured protein unsuitable for functional studies
Protein InteractionsPull-down assays for ORF8/YIF1B bindingRequires refolding for activity

Neurological and Viral Pathways

  • Neurological: YIF1B knockdown disrupts 5-HT1A receptor dendritic targeting, affecting mood regulation .

  • Viral: YIF1B mediates ORF8 secretion, enabling IL-17RA activation and exacerbating inflammation .

Therapeutic Potential

TargetApproachOutcome
COVID-19YIF1B inhibitors to block ORF8 secretionReduced cytokine storm
NeurodegenerationModulators of YIF1B traffickingEnhanced receptor targeting

Challenges and Future Directions

Key Challenges:

  1. Functional Limitations: Denatured recombinant YIF1B lacks activity for live-cell assays .

  2. Isoform Complexity: Five isoforms complicate functional studies .

Future Research:

  • Structural Biology: Resolving YIF1B-ORF8 interaction dynamics.

  • Therapeutic Development: Small-molecule inhibitors targeting YIF1B’s α4 helix .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice shipment is required, please communicate with us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference point.
Shelf Life
The shelf life of our protein products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple uses, aliquoting is recommended to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
We strive to determine the tag type during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
YIF1B; PP4519; UNQ3073/PRO9905; Protein YIF1B; YIP1-interacting factor homolog B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-314
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
YIF1B
Target Protein Sequence
MHPAGLAAAAAGTPRLRKWPSKRRIPVSQPGMADPHQLFDDTSSAQSRGYGAQRAPGGLS YPAASPTPHAAFLADPVSNMAMAYGSSLAAQGKELVDKNIDRFIPITKLKYYFAVDTMYV GRKLGLLFFPYLHQDWEVQYQQDTPVAPRFDVNAPDLYIPAMAFITYVLVAGLALGTQDR FSPDLLGLQASSALAWLTLEVLAILLSLYLVTVNTDLTTIDLVAFLGYKYVGMIGGVLMG LLFGKIGYYLVLGWCCVAIFVFMIRTLRLKILADAAAEGVPVRGARNQLRMYLTMAVAAA QPMLMYWLTFHLVR
Uniprot No.

Target Background

Function
YIF1B plays a crucial role in the anterograde trafficking pathway, facilitating the movement of proteins from the endoplasmic reticulum to the plasma membrane. It also contributes to the structural organization of the Golgi apparatus. Furthermore, YIF1B is essential for targeting receptors, such as HTR1A, to neuronal dendrites.
Database Links

HGNC: 30511

KEGG: hsa:90522

STRING: 9606.ENSP00000343435

UniGene: Hs.280741

Protein Families
YIF1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein.

Q&A

What is YIF1B and what are its primary cellular functions?

YIF1B (YIP1-interacting factor homolog B) is a protein that functions primarily in endoplasmic reticulum to Golgi vesicle-mediated transport and regulates the proper organization of these organelles . It belongs to the YIF1 family and plays an essential role in protein trafficking pathways within cells. Specifically, YIF1B is involved in targeting certain receptors to neuronal dendrites, such as the serotonin receptor HTR1A (5-HT1A) . Additionally, research has revealed its role in primary cilium and sperm flagellum assembly through protein transport to these compartments . This protein's function in membrane trafficking impacts the coordination and regulation of protein secretion and intracellular transport critical for maintaining cellular homeostasis .

Where is YIF1B primarily expressed in human tissues?

YIF1B demonstrates high expression levels in the brain, with particularly notable expression in raphe neurons that express 5-HT1A receptors . This tissue-specific expression pattern correlates with its functional role in targeting serotonin receptors to neuronal dendrites. The protein has been detected in human tissues including brain cells (such as in the U-251MG cell line) and small intestine tissue, as demonstrated by western blot and immunohistochemical analyses . The specific expression pattern suggests an important role in neuronal function and the maintenance of proper receptor distribution in the nervous system.

What are the optimal protocols for detecting YIF1B protein in tissue and cell samples?

For effective detection of YIF1B in research samples, multiple approaches are recommended:

Western Blot Analysis:

  • Extract proteins from tissues or cells by sonication in sample buffer

  • Separate proteins (approximately 1 μg) by SDS-PAGE

  • Transfer to polyvinylidene difluoride (PVDF) membrane

  • Incubate with YIF1B affinity-purified antibody at an optimized dilution (1/250 has been successfully used)

  • For recombinant protein detection, 15% SDS-PAGE is recommended for optimal resolution

  • Expected band size for the native protein is approximately 34 kDa

Immunohistochemistry (IHC):

  • Use paraffin-embedded tissue sections

  • Apply YIF1B antibody at a dilution of approximately 1/50

  • The protocol has been validated for human tissue samples, particularly intestinal tissue

When optimizing these protocols, researchers should verify specificity of detection using positive controls such as brain tissue extracts or Yif1B-transfected cell lines.

How can recombinant YIF1B protein be produced and purified for experimental use?

The production of recombinant YIF1B typically follows this methodology:

  • Express the protein in E. coli systems using an appropriate expression vector containing the YIF1B coding sequence (amino acids 1-156)

  • Include an N-terminal His-tag sequence for purification purposes

  • Induce protein expression using optimized conditions

  • Lyse cells and purify the protein using nickel affinity chromatography

  • For certain applications, the protein may be maintained in a denatured state using buffers containing urea (typically 0.4M)

  • Formulate the purified protein in an appropriate buffer such as 20 mM Tris-HCl (pH 8.0) with 10% glycerol

  • Assess purity by SDS-PAGE (should exceed 90%)

  • Store aliquots at -20°C to avoid freeze-thaw cycles

It's important to note that denatured recombinant YIF1B is more suitable for western blot or imaging assays rather than functional studies that require the native protein conformation .

What methods can be used to study YIF1B protein-protein interactions?

Several complementary methods have proven effective for investigating YIF1B interactions:

Yeast Two-Hybrid Screening:

  • Use the C-terminal domain of potential interacting partners (e.g., 5-HT1A receptor) as bait

  • Screen against a library of prey fragments

  • Select positive clones on media lacking leucine, tryptophan, and histidine

  • Amplify and sequence prey fragments to identify interacting proteins

  • Apply a scoring system to assess the reliability of interactions

GST Pull-Down Assays:

  • Express GST-fusion constructs of potential interacting domains

  • Incubate with either:

    • Protein extracts from YIF1B-transfected cell lines, or

    • Brain tissue extracts containing naturally expressed YIF1B

  • Analyze pulled-down proteins by SDS-PAGE and western blotting

Colocalization Studies:

  • Express fluorescently tagged proteins (e.g., CFP-tagged 5-HT1A receptor and FLAG-tagged YIF1B)

  • Observe subcellular localization in relevant cell models

  • Analyze colocalization in vesicular structures using confocal microscopy

  • Focus on small vesicles involved in transient intracellular trafficking

These methods should be used in combination to provide complementary evidence for protein interactions.

How does YIF1B contribute to neuronal receptor trafficking?

YIF1B plays a crucial role in the specific targeting of receptors to neuronal dendrites, particularly for the 5-HT1A serotonin receptor . The mechanism involves:

  • Direct interaction with the C-terminal domain of the 5-HT1A receptor

  • Facilitation of receptor transport from the endoplasmic reticulum to the Golgi complex

  • Involvement in post-Golgi trafficking to specific dendritic compartments

  • Colocalization with the receptor in small vesicles involved in intracellular trafficking

Research has demonstrated that when YIF1B expression is inhibited through siRNA in primary neuronal cultures, 5-HT1A receptors fail to reach distal portions of dendrites . Importantly, this effect appears to be specific to 5-HT1A receptors, as other receptors such as sst2A, P2X2, and 5-HT3A receptors remain unaffected by YIF1B knockdown . This selective involvement suggests that YIF1B is part of a specialized trafficking machinery that determines the precise subcellular localization of specific neuronal receptors.

What experimental approaches can be used to study YIF1B's role in receptor trafficking?

To investigate YIF1B's function in receptor trafficking, researchers can employ these methodological approaches:

siRNA Knockdown in Primary Neuronal Cultures:

  • Design specific siRNAs targeting YIF1B mRNA (examples of effective sequences: 5'-CCAGCCAUGGCUUUCAUAACCUACA-3' and 5'-CGGUACUCAUGUACUGGCUCACCUU-3')

  • Include appropriate control siRNAs with similar nucleotide composition but no target in the genome

  • Transfect primary neurons (typically from rat embryos) with the siRNAs

  • Express fluorescently tagged receptors of interest

  • Analyze receptor distribution along dendrites using confocal microscopy

  • Quantify receptor presence in proximal versus distal dendritic compartments

Molecular Interaction Studies:

  • Identify critical domains in both YIF1B and target receptors using truncation mutants

  • Analyze the effect of point mutations in potential interaction motifs

  • Perform co-immunoprecipitation experiments to confirm interactions in cellular contexts

  • Map the interaction interfaces using structural biology approaches

Live Cell Imaging:

  • Express fluorescently tagged YIF1B and receptor proteins

  • Track vesicular movement in real-time using live-cell confocal microscopy

  • Analyze trafficking kinetics, directionality, and response to stimuli

  • Use photoactivatable or photoconvertible fluorescent proteins to follow specific protein populations

These approaches provide complementary data on both the molecular and cellular aspects of YIF1B-mediated trafficking.

What is known about the role of YIF1B in serotonergic neurotransmission?

YIF1B has emerged as a critical regulator of serotonergic neurotransmission through its specific impact on 5-HT1A receptor localization . Key findings include:

  • YIF1B is highly expressed in serotonergic neurons of the raphe nuclei, which are the primary source of serotonergic projections in the brain

  • It specifically interacts with the C-terminal domain of the 5-HT1A receptor, a key regulator of serotonergic neurotransmission

  • This interaction is essential for proper targeting of 5-HT1A receptors to dendritic compartments

  • Disruption of YIF1B expression prevents the dendritic localization of 5-HT1A receptors

The significance of this role extends to potential implications for mood disorders and antidepressant mechanisms. Since 5-HT1A receptors are critical targets for antidepressant drugs, the regulation of their subcellular localization by YIF1B opens new avenues for understanding the molecular basis of depression and developing novel therapeutic approaches . The partnership between YIF1B and 5-HT1A receptors represents a specific molecular mechanism that contributes to the proper functioning of the serotonergic system.

How can mutations or variants in YIF1B affect its function in protein trafficking?

Analysis of mutations or variants in YIF1B requires sophisticated experimental approaches:

  • Structure-Function Analysis:

    • Generate site-directed mutants of critical residues in YIF1B

    • Focus on conserved domains across YIF1 family members

    • Express mutants in cellular models and assess their ability to rescue trafficking defects

    • Use computational predictions to identify potential regulatory sites

  • Interaction Interface Mapping:

    • Identify residues critical for binding to cargo proteins like 5-HT1A receptors

    • Determine whether mutations affect binding affinity or specificity

    • Assess whether mutations alter the subcellular localization of YIF1B itself

  • Trafficking Dynamics Analysis:

    • Compare vesicular movement kinetics between wild-type and mutant YIF1B

    • Quantify changes in trafficking efficiency using live-cell imaging

    • Measure residence time in different cellular compartments

When designing experiments to study YIF1B variants, researchers should consider using complementary approaches including biochemical assays, cellular imaging, and in vivo models to comprehensively assess functional impacts.

What is the relationship between YIF1B and other members of the intracellular trafficking machinery?

YIF1B functions within a complex network of trafficking proteins. Research approaches to understand these relationships include:

  • Comparative Analysis with YIF1 Family Members:

    • Study functional overlap and distinctions between YIF1B and related proteins

    • Determine tissue-specific expression patterns and cargo selectivity

    • Perform rescue experiments to assess functional redundancy

  • Investigation of Protein Complexes:

    • Use immunoprecipitation followed by mass spectrometry to identify YIF1B-associated proteins

    • Analyze co-trafficking with other vesicular transport components

    • Determine whether YIF1B is part of larger multiprotein complexes

  • Pathway Mapping:

    • Establish the position of YIF1B in the hierarchy of trafficking decisions

    • Identify upstream regulators and downstream effectors

    • Determine the relationship between YIF1B and known trafficking pathways (COPI, COPII, clathrin-dependent transport)

Understanding these relationships is essential for placing YIF1B in the broader context of cellular trafficking mechanisms and may reveal additional functions beyond those currently described.

How can advanced imaging techniques be applied to study YIF1B dynamics in live cells?

Advanced imaging methodologies offer powerful approaches for investigating YIF1B trafficking dynamics:

  • Super-Resolution Microscopy:

    • Apply techniques such as STED, PALM, or STORM to visualize YIF1B-containing vesicles below the diffraction limit

    • Achieve nanoscale resolution of trafficking events at specialized cellular compartments

    • Precisely map YIF1B distribution relative to organelle markers

  • Multi-Color Live-Cell Imaging:

    • Simultaneously track YIF1B and its cargo proteins with different fluorescent tags

    • Monitor transitions between cellular compartments in real-time

    • Quantify co-trafficking events and calculate correlation coefficients

  • Photoactivation and FRAP Experiments:

    • Use photoactivatable GFP-tagged YIF1B to track specific protein populations

    • Perform Fluorescence Recovery After Photobleaching (FRAP) to measure protein mobility

    • Calculate diffusion coefficients and exchange rates between compartments

  • Correlative Light and Electron Microscopy (CLEM):

    • Combine live-cell fluorescence imaging with subsequent electron microscopy

    • Achieve molecular specificity with nanometer-scale resolution

    • Visualize YIF1B-containing vesicles in their ultrastructural context

These advanced techniques allow researchers to move beyond static observations and capture the dynamic aspects of YIF1B function in physiologically relevant contexts.

What are the key considerations when designing siRNA experiments to knock down YIF1B expression?

Effective siRNA experiments targeting YIF1B require careful methodological considerations:

Design and Validation:

  • Design multiple siRNA sequences targeting different regions of YIF1B mRNA

  • Previously validated sequences include:

    • siRNA(Yif1B-1): 5'-CCAGCCAUGGCUUUCAUAACCUACA-3' (nucleotides 509–533)

    • siRNA(Yif1B-2): 5'-CGGUACUCAUGUACUGGCUCACCUU-3' (nucleotides 937–961)

  • Create control siRNAs with similar nucleotide composition but no genomic targets:

    • Control for siRNA-1: 5'-CCAGUACUUCGUACUCCAAUCGACA-3'

    • Control for siRNA-2: 5'-CGGACUCAUGCGGUCACUCCAUCUU-3'

Optimization Table for siRNA Transfection in Neuronal Cultures:

ParameterRecommended RangeOptimization Notes
siRNA concentration20-100 nMTest multiple concentrations to balance knockdown efficiency with toxicity
Transfection reagentLipofectamine RNAiMAX, NeuromagSelect reagents optimized for neuronal cultures
Time post-transfection48-72 hoursMonitor knockdown efficiency at multiple timepoints
Verification methodqRT-PCR, Western blotConfirm knockdown at both mRNA and protein levels
Control conditionsNon-targeting siRNA, untransfectedAlways include both negative controls

Critical Considerations:

  • Validate knockdown efficiency at both mRNA and protein levels

  • Assess potential off-target effects using transcriptomic approaches

  • Include rescue experiments with siRNA-resistant YIF1B constructs

  • Consider the developmental stage of neurons when designing experiments

  • Optimize transfection conditions specifically for your neuronal culture system

What are the optimal storage and handling conditions for recombinant YIF1B protein?

To maintain the integrity and activity of recombinant YIF1B protein, researchers should follow these guidelines:

Storage Recommendations:

  • For short-term storage (up to 1 month), keep at 4°C in appropriate buffer

  • For long-term storage, store aliquoted samples at -20°C

  • Avoid repeated freeze-thaw cycles which can lead to protein degradation

  • Consider adding glycerol (typically 10%) to storage buffer to prevent freeze-thaw damage

Buffer Composition:
The recommended buffer for recombinant YIF1B storage is 20 mM Tris-HCl buffer (pH 8.0) containing 10% glycerol . For denatured preparations, 0.4M urea is included to maintain the denatured state.

Handling Precautions:

  • Work with the protein on ice when possible

  • Centrifuge briefly before opening tubes to collect protein solution

  • Use low-binding microcentrifuge tubes to minimize protein loss

  • Consider adding protease inhibitors if working with the protein for extended periods

  • Perform quality control by SDS-PAGE after extended storage periods

How can researchers troubleshoot common issues in YIF1B detection and functional assays?

Western Blot Detection Issues:

ProblemPossible CausesSolutions
No detection of YIF1BLow protein expression, antibody issuesIncrease protein loading (3-5 μg), optimize antibody dilution, use fresh antibody
Multiple bandsNon-specific binding, protein degradationIncrease blocking time, add Tween-20 to washing buffer, add protease inhibitors during extraction
Unexpected molecular weightPost-translational modifications, alternative splicingUse positive control with known molecular weight, consider denaturing conditions
High backgroundInsufficient blocking, excessive antibodyIncrease blocking time, reduce antibody concentration, increase washing steps

Functional Assay Troubleshooting:

  • Protein-Protein Interaction Studies:

    • Validate antibody specificity with appropriate controls

    • Include positive and negative interaction controls

    • Consider the effect of detergents on protein-protein interactions

    • Optimize salt concentration in buffers to maintain specific interactions

  • Trafficking Assays:

    • Ensure expression levels of fluorescent constructs are not too high to avoid aggregation

    • Validate that fluorescent tags do not interfere with protein function

    • Include proper controls for specificity of trafficking effects

    • Consider the timing of observations relative to protein expression

  • siRNA Experiments:

    • Confirm knockdown efficiency before interpreting trafficking results

    • Use multiple siRNA sequences to rule out off-target effects

    • Consider the half-life of the target protein when determining optimal timepoints

    • Include rescue experiments with siRNA-resistant constructs

How might YIF1B research contribute to understanding neurological and psychiatric disorders?

Given YIF1B's critical role in targeting the 5-HT1A serotonin receptor to neuronal dendrites, it represents a promising research target for understanding and potentially treating neurological and psychiatric disorders:

  • Depression and Anxiety Disorders:

    • The 5-HT1A receptor is a key target of antidepressant medications

    • Altered dendritic localization of 5-HT1A receptors could impact treatment efficacy

    • YIF1B dysfunction might contribute to serotonergic abnormalities in mood disorders

    • Research could focus on how antidepressants affect YIF1B expression or function

  • Neurodevelopmental Disorders:

    • Proper protein trafficking is essential for neuronal development and circuit formation

    • YIF1B dysfunction during critical developmental periods could impact neuronal connectivity

    • Research could examine YIF1B expression patterns during brain development

    • Genetic studies might identify YIF1B variants associated with neurodevelopmental conditions

  • Neurodegenerative Diseases:

    • Protein trafficking defects are implicated in several neurodegenerative disorders

    • YIF1B's role in maintaining ER-Golgi organization may be relevant to proteostasis

    • Research could investigate whether YIF1B function is altered in models of neurodegeneration

    • Therapeutic approaches might target YIF1B to restore proper receptor trafficking

What are the emerging technologies that could advance YIF1B research?

Several cutting-edge technologies show promise for advancing our understanding of YIF1B:

  • CRISPR/Cas9 Genome Editing:

    • Generate precise knockouts or knock-ins of YIF1B in cellular and animal models

    • Create tagged versions of endogenous YIF1B to avoid overexpression artifacts

    • Introduce specific mutations to assess structure-function relationships

    • Develop conditional knockout systems to study YIF1B in specific cell types or developmental stages

  • Cryo-Electron Microscopy:

    • Determine the three-dimensional structure of YIF1B alone and in complex with binding partners

    • Visualize YIF1B in the context of trafficking vesicles at molecular resolution

    • Identify structural changes associated with cargo binding and release

  • Single-Cell Omics Approaches:

    • Analyze cell-type-specific expression patterns of YIF1B in the brain

    • Identify co-expressed genes that may function in the same trafficking pathway

    • Study how YIF1B expression changes in response to neuronal activity or disease states

  • Optogenetic and Chemogenetic Tools:

    • Develop light- or drug-inducible systems to acutely manipulate YIF1B function

    • Study the temporal aspects of receptor trafficking in response to YIF1B activation

    • Combine with live imaging to visualize trafficking events in real-time

How can computational approaches enhance our understanding of YIF1B function?

Computational methods offer powerful complementary approaches to experimental studies of YIF1B:

  • Structural Prediction and Molecular Dynamics:

    • Predict the three-dimensional structure of YIF1B using homology modeling or AI-based approaches

    • Simulate interactions between YIF1B and binding partners

    • Model conformational changes associated with different functional states

    • Identify potential binding pockets for small molecule modulators

  • Network Analysis:

    • Integrate YIF1B into protein-protein interaction networks

    • Identify functional modules associated with YIF1B in different cell types

    • Predict additional functions based on network connectivity

    • Map how trafficking networks are altered in disease states

  • Machine Learning Applications:

    • Analyze imaging data to automatically quantify trafficking events

    • Develop predictive models for YIF1B-binding motifs in cargo proteins

    • Identify patterns in experimental data that may not be apparent through traditional analysis

    • Screen for potential small molecule modulators of YIF1B function

  • Systems Biology Approaches:

    • Model the impact of YIF1B dysfunction on cellular trafficking pathways

    • Simulate how alterations in YIF1B expression affect receptor distribution

    • Integrate multiple datasets to understand YIF1B in the broader context of cellular function

    • Predict cellular consequences of YIF1B mutations or expression changes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.