Recombinant Human Protein YIPF1 (YIPF1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Protein YIPF1

Recombinant Human Protein YIPF1 is a full-length protein consisting of 306 amino acids that belongs to the YIP1 family member 1 classification. It is identified by the UniProt ID Q9Y548 and serves as a homolog of yeast Yif1p protein . The recombinant version of this protein is produced through genetic engineering techniques, typically expressed in prokaryotic systems such as Escherichia coli, and often includes fusion tags like histidine (His) to facilitate purification and detection . YIPF1 represents one of nine members of the YIPF family in mammalian cells, specifically categorized within the YIPFβ/Yif1p subfamily alongside YIPF2, YIPF3, YIF1A, and YIF1B .

The significance of YIPF1 primarily stems from its involvement in cellular transport mechanisms, particularly in vesicular trafficking between the endoplasmic reticulum (ER) and Golgi apparatus. Research has demonstrated that YIPF1 plays a crucial role in maintaining Golgi structure and function, supporting glycan synthesis, and participating in complex formation with other YIPF proteins to facilitate membrane transport processes . These functions make YIPF1 an important subject for research in cellular biology, particularly in understanding the mechanisms of protein trafficking and secretion.

Post-translational Modifications

While detailed information about the specific post-translational modifications of YIPF1 is limited in the provided search results, the protein likely undergoes modifications common to membrane-associated proteins involved in vesicular transport. These might include phosphorylation, glycosylation, or lipid modifications that regulate its localization, interaction capabilities, and functional activities within the cell.

Expression Systems

Recombinant Human Protein YIPF1 is commonly expressed in E. coli expression systems . This prokaryotic expression platform offers several advantages for protein production, including rapid growth, high protein yield, and relatively straightforward genetic manipulation. The expression construct typically includes the full-length YIPF1 coding sequence (amino acids 1-306) with an N-terminal histidine tag to facilitate purification .

Subcellular Localization

Immunofluorescence staining studies have revealed that YIPF1 primarily localizes in the medial-/trans-Golgi and partially in the trans-Golgi network (TGN) . This localization pattern is critical for understanding its function in the cellular transport machinery. When treated with brefeldin A (BFA), a fungal metabolite that disrupts the Golgi apparatus, YIPF1 co-migrates partly with medial-/trans-Golgi markers and also with TGN markers in the early phase, but eventually redistributes within cytoplasmic punctate structures distinct from Golgi and TGN markers . This response to BFA treatment provides insights into the dynamic localization and potential roles of YIPF1 in Golgi structure maintenance.

Protein Interactions

YIPF1 forms specific protein complexes that are essential for its function. Notably, YIPF6 (a homolog of yeast Yip1p) forms a stable complex with YIPF1 . This interaction is significant as knockdown of YIPF6 reduces YIPF1 levels, suggesting that YIPF1 stability depends on its association with YIPF6 . The molecular architecture of YIPF complexes is intricate, with a YIPFα molecule (like YIPF6) forming a complex with a specific partner YIPFβ molecule (like YIPF1). Current models suggest that these complexes form as basic tetramers consisting of two molecules of each partner YIPF protein, which can further organize into higher-order oligomers .

The interaction network of YIPF proteins extends beyond their family members. YIPF proteins form a core physical interaction network with various Ypt/Rab GTPases, which are key regulators of membrane trafficking . This network connects with other proteins involved in membrane trafficking, including SNAREs and COPII components, highlighting the integrated role of YIPF1 in the broader vesicular transport machinery .

Role in Vesicular Transport

YIPF1, as part of the YIPF family, plays a significant role in vesicular transport between the ER and Golgi apparatus. The YIPF proteins are proposed to function in vesicle budding and/or fusion at the Golgi apparatus, based on their interactions with Ypt/Rab GTPases that regulate these processes . Specifically, the Yip1p-Yif1p complex (of which YIPF1 is a mammalian homolog) has been implicated in establishing the fusion competence of ER-derived vesicles at the vesicle budding step .

Research findings suggest that loss of function of the YIPF complex causes a block in ER to Golgi transport, emphasizing its essential role in this cellular pathway . The specific mechanism may involve coordinating vesicle flow between the ER and Golgi by participating in both vesicle budding and fusion processes .

Golgi Apparatus Maintenance

Experimental evidence indicates that YIPF1 contributes to the maintenance of Golgi apparatus structure and function. Knockdown experiments have shown that while the structure of the Golgi apparatus and its disassembly after BFA treatment are not significantly affected by YIPF1 knockdown, the reassembly of the Golgi apparatus after BFA removal is markedly delayed . This suggests that YIPF1 plays a crucial role in the recovery and reformation of the Golgi apparatus following disruption.

Additionally, knockdown of YIPF1 reduces intracellular glycans in HT-29 cells, confirming its importance in supporting normal glycan synthesis . This finding highlights the functional significance of YIPF1 in maintaining the glycosylation machinery within the Golgi apparatus, which is essential for proper protein processing and secretion.

Experimental Methodologies

Recombinant Human Protein YIPF1 serves as a valuable tool in cellular biology research, particularly for studying protein-protein interactions, vesicular transport mechanisms, and Golgi apparatus dynamics. Common experimental approaches using recombinant YIPF1 include:

  1. Knockdown and Overexpression Studies: Manipulating YIPF1 expression levels to observe effects on Golgi structure, protein trafficking, and glycosylation .

  2. Immunofluorescence Staining: Visualizing the subcellular localization of YIPF1 and its co-localization with other organelle markers .

  3. Protein-Protein Interaction Assays: Investigating YIPF1's interactions with other YIPF family members and components of the vesicular transport machinery .

  4. Drug Response Studies: Examining the behavior of YIPF1 following treatment with agents like brefeldin A that disrupt the Golgi apparatus .

Potential Therapeutic Relevance

While the direct therapeutic applications of YIPF1 are not explicitly discussed in the provided search results, its fundamental role in cellular transport processes suggests potential relevance to disease states associated with protein trafficking defects. Disorders related to glycosylation, protein secretion, or Golgi dysfunction might be influenced by YIPF1 activity, making it a potential target for further investigation in disease research.

Additionally, the high expression of YIPF3 (another YIPF family member) in immune organs and its upregulation in response to polyinosine-polycytidylic acid suggests a possible role for YIPF proteins in immune responses . By analogy, YIPF1 might also contribute to cellular adaptation during immune challenges, though specific evidence for this function in YIPF1 is not provided in the search results.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YIPF1; Protein YIPF1; YIP1 family member 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
YIPF1
Target Protein Sequence
MAAVDDLQFEEFGNAATSLTANPDATTVNIEDPGETPKHQPGSPRGSGREEDDELLGNDD SDKTELLAGQKKSSPFWTFEYYQTFFDVDTYQVFDRIKGSLLPIPGKNFVRLYIRSNPDL YGPFWICATLVFAIAISGNLSNFLIHLGEKTYHYVPEFRKVSIAATIIYAYAWLVPLALW GFLMWRNSKVMNIVSYSFLEIVCVYGYSLFIYIPTAILWIIPQKAVRWILVMIALGISGS LLAMTFWPAVREDNRRVALATIVTIVLLHMLLSVGCLAYFFDAPEMDHLPTTTATPNQTV AAAKSS
Uniprot No.

Target Background

Gene References Into Functions
  1. Knockdown of YIPF1 and YIPF2, but not YIPF6, reduced intracellular glycans in HT-29 cells. This confirms the significant role of YIPF1, YIPF2, and YIPF6 in supporting normal glycan synthesis. PMID: 28286305
Database Links

HGNC: 25231

OMIM: 617521

KEGG: hsa:54432

STRING: 9606.ENSP00000072644

UniGene: Hs.11923

Protein Families
YIP1 family
Subcellular Location
Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein. Golgi apparatus, trans-Golgi network membrane. Late endosome membrane.

Q&A

What is the basic structural organization of human YIPF1 protein?

Human YIPF1 is a multi-pass membrane protein belonging to the YIP1 family of proteins . It contains multiple transmembrane domains forming hairpin structures, with extended amino and/or carboxyl termini that extend into the cytosol. This topology allows YIPF1 to interact with various proteins while remaining anchored in the membrane. YIPF1 shares structural similarities with other Yip family members, though they differ in the number of transmembrane domains and their specific subcellular localizations . The protein is encoded by the YIPF1 gene (Entrez Gene ID: 54432) and is also known by several aliases including FinGER1 and DJ167A19.1 . Human YIPF1 shares approximately 71% sequence identity with both mouse and rat orthologs, indicating a relatively high degree of evolutionary conservation among mammals .

Where is YIPF1 primarily localized within the cell?

Immunofluorescence studies have revealed that YIPF1 primarily localizes to the medial-/trans-Golgi compartments and partially to the trans-Golgi network (TGN) . This localization is consistent with its proposed function in vesicular trafficking and Golgi maintenance. When cells are treated with brefeldin A (BFA), which disrupts the Golgi apparatus, YIPF1 initially co-migrates with medial-/trans-Golgi markers and the TGN marker, but eventually redistributes to distinct cytoplasmic punctate structures that are separate from the typical Golgi markers . This dynamic relocalization upon Golgi disruption suggests YIPF1 associates with specific Golgi membrane domains and follows distinct trafficking pathways during organelle reorganization.

What functional roles does YIPF1 play in cellular processes?

YIPF1 serves several critical functions in cellular processes:

  • Golgi Structure Maintenance: YIPF1, in complex with YIPF6, contributes to the stable expression and localization of proteins within the Golgi apparatus .

  • Golgi Reassembly: Knockdown experiments have demonstrated that YIPF1 is necessary for efficient reassembly of the Golgi apparatus after disruption by brefeldin A treatment .

  • Glycan Synthesis: YIPF1 plays a significant role in supporting normal glycan synthesis, as evidenced by reduced intracellular glycan levels in HT-29 cells following YIPF1 knockdown .

  • Membrane Trafficking: As part of the larger Yip family, YIPF1 likely participates in membrane trafficking processes between the ER and Golgi, possibly through interactions with Rab GTPases (mammalian homologs of yeast Ypt proteins) .

  • Membrane Shaping: YIPF1 belongs to a superfamily of membrane-shaping adapter proteins (MSAPs) that both alter membrane structure and interact with other proteins, suggesting a role in membrane organization .

How does YIPF1 interact with other Yip family proteins to form functional complexes?

YIPF1 forms a stable complex with YIPF6, which is essential for the proper expression and localization of YIPF1 within the Golgi apparatus . Specifically, YIPF6 forms complexes separately with both YIPF1 and YIPF2. Knockdown experiments have shown that reducing YIPF6 expression leads to decreased levels of both YIPF1 and YIPF2, indicating that YIPF6 is necessary for the stable expression of these proteins .

Interestingly, the dependency relationship is not reciprocal—YIPF1 and YIPF2 are not required for the expression and localization of YIPF6 . This asymmetric dependency suggests a hierarchical organization within the YIPF protein network, with YIPF6 acting as a primary stabilizing factor for its interaction partners.

The interactions between these proteins likely involve their transmembrane domains and/or cytosolic portions, similar to what has been observed in yeast homologs where Yip1p and Yif1p interact through their cytosolic amino termini . These protein-protein interactions are critical for maintaining the integrity of the Golgi apparatus and ensuring proper vesicular trafficking functions.

What is the role of YIPF1 in Golgi apparatus reassembly after brefeldin A treatment?

The reassembly of the Golgi apparatus after brefeldin A (BFA) removal is significantly impaired when YIPF1 or YIPF2 is knocked down, but not when YIPF6 is depleted . This finding suggests a specialized role for YIPF1 in Golgi biogenesis and maintenance that is distinct from its interaction partner YIPF6.

The mechanism behind this phenomenon appears to involve the regulation of free YIPF6. When YIPF1 and YIPF2 are knocked down, free YIPF6 (not complexed with YIPF1/YIPF2) increases, which interferes with the reassembly of the Golgi apparatus . This suggests that balanced stoichiometry between these proteins is crucial for proper Golgi structure maintenance.

Methodologically, researchers studying this process typically:

  • Treat cells with BFA to disrupt the Golgi

  • Wash out the BFA to allow for Golgi reassembly

  • Monitor reassembly kinetics using Golgi markers in control versus YIPF1/YIPF2/YIPF6 knockdown cells

  • Quantify the percentage of cells with reassembled Golgi at various time points after BFA washout

This experimental approach has revealed that YIPF1 plays a critical role in organizing Golgi membranes during the reassembly process, potentially by facilitating the fusion of Golgi fragments or by recruiting structural components necessary for Golgi stack formation.

How does YIPF1 contribute to glycan synthesis and what are the implications for cellular glycosylation?

YIPF1, along with YIPF2, plays a crucial role in supporting normal glycan synthesis. Knockdown of YIPF1 and YIPF2 reduces intracellular glycan levels in HT-29 cells, while knockdown of YIPF6 does not produce this effect . This differential impact suggests that YIPF1 and YIPF2 have specific functions in glycosylation pathways that are independent of their interactions with YIPF6.

The mechanism by which YIPF1 supports glycan synthesis likely involves:

  • Maintenance of Golgi structure: Proper glycosylation requires the ordered distribution of glycosyltransferases within the Golgi cisternae. YIPF1's role in Golgi structure maintenance may ensure that these enzymes remain in their correct locations.

  • Vesicular trafficking: Efficient transport of glycosylation substrates and glycosyltransferases through the Golgi is necessary for complete glycosylation. YIPF1 may facilitate this trafficking as part of its function in the Yip family.

  • Enzyme retention: YIPF1 might contribute to the retention of specific glycosyltransferases within the medial/trans-Golgi compartments where they function.

The implications of YIPF1's role in glycosylation extend to multiple cellular processes, as glycans are crucial for protein folding, stability, and function. Alterations in cellular glycosylation due to YIPF1 dysfunction could potentially impact:

  • Protein secretion efficiency

  • Cell-cell recognition and adhesion

  • Receptor signaling

  • Immune system functions

  • Extracellular matrix organization

What are the optimal methods for detecting and quantifying YIPF1 expression in experimental systems?

Several complementary methods can be employed for detecting and quantifying YIPF1 expression:

  • ELISA-based detection: Human Protein YIPF1 ELISA kits provide sensitive and specific detection of YIPF1. These assays show no significant cross-reactivity with analogues and demonstrate high reproducibility with standard deviations less than 8% for repeated measurements on the same plate and less than 10% between different operators .

  • Immunofluorescence staining: This method is particularly valuable for determining the subcellular localization of YIPF1. Using specific antibodies against YIPF1, researchers can visualize its distribution within the Golgi apparatus and track changes in localization following experimental manipulations .

  • Western blotting: For quantifying total YIPF1 protein levels, western blotting with specific antibodies can be employed. Recombinant YIPF1 protein fragments can serve as positive controls or for antibody validation .

  • qRT-PCR: For measuring YIPF1 mRNA expression levels, quantitative real-time PCR provides a sensitive method to assess transcriptional changes.

When designing experiments to detect YIPF1, researchers should consider:

  • Using recombinant YIPF1 fragments as controls for antibody specificity

  • For blocking experiments in immunohistochemistry/immunocytochemistry and western blotting, a 100x molar excess of protein fragment control is recommended, with pre-incubation of the antibody-protein control fragment mixture for 30 minutes at room temperature

  • Including appropriate Golgi markers (medial-/trans-Golgi and TGN markers) for co-localization studies

What are effective strategies for manipulating YIPF1 expression to study its function?

Several approaches can be employed to modulate YIPF1 expression levels:

  • RNA interference (RNAi):

    • siRNA or shRNA targeting YIPF1 can effectively reduce its expression

    • Previous studies have successfully used this approach to demonstrate YIPF1's role in Golgi reassembly and glycan synthesis

    • When designing knockdown experiments, researchers should verify knockdown efficiency by both qRT-PCR and western blotting

  • CRISPR/Cas9 gene editing:

    • For complete knockout or targeted mutations of YIPF1

    • Useful for studying long-term consequences of YIPF1 loss in stable cell lines

    • Potential compensation by other family members should be considered

  • Overexpression systems:

    • Plasmid vectors containing YIPF1 cDNA with appropriate tags (e.g., GFP, FLAG)

    • Allows for visualization of overexpressed protein and pull-down experiments

    • Both transient and stable overexpression systems can be employed depending on experimental needs

  • Inducible expression systems:

    • Tetracycline-inducible or similar systems allow for controlled expression timing

    • Useful for distinguishing between acute and chronic effects of YIPF1 manipulation

When interpreting results from these manipulations, researchers should consider potential compensatory mechanisms by other Yip family members and distinguish between direct and indirect effects of YIPF1 modulation.

How can researchers effectively study YIPF1's interactions with other proteins?

To investigate YIPF1's protein-protein interactions, several complementary approaches can be employed:

  • Co-immunoprecipitation (Co-IP):

    • Useful for confirming interactions between YIPF1 and suspected binding partners

    • Can be performed with endogenous proteins or with tagged overexpressed versions

    • Special consideration should be given to detergent selection, as YIPF1 is a membrane protein

  • Proximity labeling methods:

    • BioID or APEX2 fusion proteins can identify proteins in close proximity to YIPF1 in living cells

    • Particularly valuable for identifying transient or weak interactions that might be lost during co-IP

  • Yeast two-hybrid (Y2H) screening:

    • Similar to how yeast Yip proteins were originally identified as Ypt-interacting proteins

    • Most suitable for the cytosolic domains of YIPF1, as transmembrane domains are problematic in Y2H systems

  • Fluorescence resonance energy transfer (FRET):

    • For studying interactions in living cells

    • Requires fluorescent protein tagging of both YIPF1 and potential interaction partners

  • Mass spectrometry-based interactomics:

    • After immunoprecipitation, mass spectrometry can identify numerous interaction partners

    • Requires careful controls to distinguish specific from non-specific interactions

When studying YIPF1 interactions, researchers should be mindful that:

  • As a multi-pass membrane protein, some interactions may depend on the lipid environment

  • The formation of complexes with other Yip family members (particularly YIPF6) may influence which other proteins can interact with YIPF1

  • Both stable and transient interactions may be functionally important

What are the unresolved questions regarding YIPF1's precise molecular function?

Despite progress in understanding YIPF1, several key questions remain unresolved:

  • Exact molecular mechanism: While YIPF1 is known to be important for Golgi structure and function, the precise molecular mechanisms by which it exerts these effects remain unclear. Does it primarily function as a scaffold, a membrane-shaping protein, or through direct regulation of vesicular trafficking machinery?

  • Cargo specificity: It remains to be determined whether YIPF1 exhibits specificity for certain cargo proteins during trafficking, similar to how yeast Yip proteins show specificity in their interactions with different Ypt GTPases .

  • Regulation of YIPF1: The mechanisms controlling YIPF1 expression, localization, and activity (including potential post-translational modifications) are largely unknown.

  • Disease relevance: Despite its important cellular functions, YIPF1's potential involvement in human diseases has not been thoroughly investigated.

  • Non-Golgi functions: While primarily localized to the Golgi, YIPF1 may have additional functions in other cellular compartments that have not yet been characterized.

Methodological approaches to address these questions could include:

  • Cryo-electron microscopy to determine the structural basis of YIPF1's membrane association and protein interactions

  • Global proteomic and glycomic analyses in YIPF1-depleted cells to identify affected pathways

  • Systems biology approaches to place YIPF1 within the broader context of membrane trafficking networks

How do YIPF1 functions compare across different cell types and organisms?

The expression patterns and functional importance of YIPF1 likely vary across different cell types and organisms, but comprehensive comparative studies are lacking. Future research should address:

  • Cell type-specific expression: Determining whether certain cell types (e.g., those with extensive secretory activity) have higher YIPF1 expression or rely more heavily on its function.

  • Tissue-specific functions: Investigating whether YIPF1 has specialized roles in particular tissues, especially those with unique secretory requirements.

  • Evolutionary conservation: While sequence homology suggests conservation (71% identity between human and rodent orthologs) , functional conservation across species requires further investigation. The relationship between mammalian YIPF1 and its yeast counterparts (likely Yif1p) could provide insights into evolutionarily conserved mechanisms .

  • Functional redundancy: Determining the extent to which other Yip family members can compensate for YIPF1 loss in different cell types and organisms.

Research approaches to address these questions could include:

  • Single-cell RNA sequencing to map YIPF1 expression across cell types

  • Conditional knockout models to assess tissue-specific requirements

  • Comparative studies in model organisms from yeast to mammals

  • Cross-complementation experiments to test functional conservation

What emerging technologies could advance YIPF1 research?

Several cutting-edge technologies hold promise for deepening our understanding of YIPF1:

  • Super-resolution microscopy: Techniques like STORM, PALM, or STED could reveal YIPF1's precise localization within Golgi subdomains at nanometer resolution, providing insights into its spatial organization and dynamics.

  • Optogenetics: Light-controlled recruitment or activation of YIPF1 could allow temporal dissection of its functions in living cells.

  • In vitro reconstitution systems: Reconstituting YIPF1 into synthetic membrane systems could directly test its membrane-shaping capabilities and interactions with other trafficking components.

  • Cryo-electron tomography: This technique could visualize YIPF1's arrangement within native cellular membranes at molecular resolution.

  • Interactome mapping: Proximity labeling approaches combined with quantitative proteomics could provide comprehensive maps of YIPF1's protein interaction network under different conditions.

  • Single-molecule tracking: Following individual YIPF1 molecules in living cells could reveal dynamic behaviors not apparent in population-averaged measurements.

These technologies could help resolve outstanding questions about YIPF1's molecular mechanism, dynamics, and functional interactions within the complex environment of the Golgi apparatus.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.