Recombinant Human Protein YIPF2 (YIPF2)

Shipped with Ice Packs
In Stock

Description

Introduction to YIPF2

YIPF2, also known as FinGER2 or MGC3262, is a member of the Yip1 domain family of proteins . The gene encoding YIPF2 in humans is located on the genome with Gene ID 78992, producing a transcript with mRNA reference sequence NM_024029.3 and a protein with reference sequence NP_076934.1 . The protein is cataloged in the UniProt database under the identifier Q9BWQ6 .

YIPF2 belongs to the YIP protein family, whose name originates from the Ypt (yeast RAB GTPase)-interacting protein . This family of proteins has been established as important regulators of intracellular trafficking processes, particularly those involving the Golgi apparatus and endoplasmic reticulum . The significance of YIPF2 extends beyond basic cellular processes, as recent research has implicated this protein in cancer progression and response to chemotherapy .

YIPF Protein Family Classification

YIPF2 is one of several YIPF proteins identified in humans, including YIPF1, YIPF3, YIPF4, YIPF5, and YIPF6 . These proteins share structural similarities but may have distinct subcellular localizations and functions. While YIPF3 and YIPF4 are known to localize to the cis-Golgi, and YIPF5 cycles between the endoplasmic reticulum and Golgi apparatus, YIPF1, YIPF2, and YIPF6 are specifically localized to the medial-/trans-Golgi and trans-Golgi network .

Available Variants

Several variants of recombinant YIPF2 are available for research purposes, including:

  1. Human YIPF2 with His-Tag

  2. Human YIPF2 with MYC/DDK-tag

  3. Human YIPF2 with GST-tag

  4. Rat YIPF2 with His (Fc)-Avi-tag

  5. Mouse YIPF2 with His (Fc)-Avi-tag

  6. Zebrafish YIPF2

These variants provide researchers with flexibility in experimental design, allowing for different detection methods and applications depending on the specific tags attached to the recombinant protein.

Subcellular Localization

YIPF2 is primarily localized to the medial-/trans-Golgi and trans-Golgi network compartments . In human brain tissue, it displays cytoplasmic expression, sometimes with a distinctive granular pattern that is consistent with its Golgi localization . This specific localization suggests that YIPF2 plays important roles in trafficking processes that occur in these regions of the Golgi apparatus.

Function in Golgi Apparatus

Research has demonstrated that YIPF2, along with YIPF1 and YIPF6, plays crucial roles in Golgi reassembly and glycan synthesis . As a member of the Yip domain family, YIPF2 contributes to the maintenance of Golgi structure and function, which is essential for proper protein modification and sorting in the secretory pathway.

Role as a Rab-GDF

YIPF2 functions as a Rab-GDF (GDI-displacement factor), which regulates multiple independent trafficking steps within the cell . One of its key functions includes recruiting and activating Rab5, a small GTPase involved in early endosome formation and trafficking . Through this activity, YIPF2 influences multiple vesicular transport processes that are critical for normal cellular function.

YIPF2 in Non-Small Cell Lung Cancer

Recent studies have identified a significant role for YIPF2 in non-small cell lung cancer (NSCLC). Research has shown that YIPF2 promotes chemotherapeutic agent-mediated apoptosis in NSCLC cells, primarily by enhancing the recycling of TNFRSF10B (TNF Receptor superfamily member 10B, also known as DR5 or TRAIL-R2) to the plasma membrane .

When NSCLC cells are treated with pemetrexed (PEM), a chemotherapeutic agent, the expression of YIPF2 is markedly increased . This upregulation of YIPF2 subsequently enhances the expression levels of cleaved CASP8, CASP3, and PARP1, which are markers of the extrinsic apoptosis pathway . These findings suggest that YIPF2 plays a role in sensitizing cancer cells to chemotherapy-induced apoptosis.

YIPF2-Mediated TNFRSF10B Trafficking

A key mechanism through which YIPF2 promotes apoptosis involves its regulation of TNFRSF10B trafficking. TNFRSF10B is a death receptor that, when activated by its ligand, initiates the extrinsic apoptosis pathway. The surface expression of TNFRSF10B is critical for its function in inducing apoptosis.

Research has demonstrated that overexpression of YIPF2 increases the levels of TNFRSF10B on the plasma membrane . This effect is not due to changes in TNFRSF10B mRNA levels, as neither overexpression nor knockdown of YIPF2 substantially alters the transcription of the TNFRSF10B gene . Instead, YIPF2 appears to enhance the stability of TNFRSF10B protein and promotes its recycling to the plasma membrane .

Prognostic Significance in Lung Cancer

Bioinformatic analyses using public databases have revealed that YIPF2 expression is significantly lower in lung adenocarcinoma tissues compared to normal tissues . Similarly, TNFRSF10B expression is also reduced in lung cancer tissues . These findings suggest that the downregulation of YIPF2 and TNFRSF10B may contribute to lung cancer progression.

Furthermore, higher expression of YIPF2 correlates with better first-progression survival and post-progression survival in chemotherapy-treated patients . This correlation supports the hypothesis that YIPF2 enhances the effectiveness of chemotherapy by promoting apoptosis in cancer cells.

Interaction with RAB Proteins

As a member of the YIP family, YIPF2 interacts with RAB proteins, which are small GTPases that regulate various steps of membrane trafficking . In particular, YIPF2 has been shown to interact with RAB8, a GTPase involved in vesicular transport from the trans-Golgi network to the plasma membrane .

Co-immunoprecipitation (co-IP) assays have confirmed the physical interaction between YIPF2 and endogenous RAB8 in cancer cells . This interaction is functionally significant, as RAB8 has been shown to decrease the surface expression of TNFRSF10B by promoting its removal from the plasma membrane to the cytoplasm .

Regulation of TNFRSF10B Trafficking

YIPF2 forms a complex with both RAB8 and TNFRSF10B, as demonstrated by co-IP experiments . Interestingly, YIPF2 inhibits the physical interaction between TNFRSF10B and RAB8 . This inhibition suppresses the RAB8-mediated removal of TNFRSF10B from the plasma membrane to the cytoplasm, thereby maintaining high levels of TNFRSF10B on the cell surface .

This molecular mechanism explains how YIPF2 enhances the sensitivity of cancer cells to chemotherapy-induced apoptosis. By increasing the surface expression of death receptors like TNFRSF10B, YIPF2 facilitates the activation of the extrinsic apoptosis pathway in response to chemotherapeutic agents .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you require a specific format, please specify it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
YIPF2; Protein YIPF2; YIP1 family member 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-316
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
YIPF2
Target Protein Sequence
MASADELTFHEFEEATNLLADTPDAATTSRSDQLTPQGHVAVAVGSGGSYGAEDEVEEES DKAALLQEQQQQQQPGFWTFSYYQSFFDVDTSQVLDRIKGSLLPRPGHNFVRHHLRNRPD LYGPFWICATLAFVLAVTGNLTLVLAQRRDPSIHYSPQFHKVTVAGISIYCYAWLVPLAL WGFLRWRKGVQERMGPYTFLETVCIYGYSLFVFIPMVVLWLIPVPWLQWLFGALALGLSA AGLVFTLWPVVREDTRLVATVLLSVVVLLHALLAMGCKLYFFQSLPPENVAPPPQITSLP SNIALSPTLPQSLAPS
Uniprot No.

Target Background

Database Links

HGNC: 28476

OMIM: 617522

KEGG: hsa:78992

STRING: 9606.ENSP00000253031

UniGene: Hs.164026

Protein Families
YIP1 family
Subcellular Location
Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein. Golgi apparatus, trans-Golgi network membrane. Late endosome membrane.

Q&A

What is YIPF2 and what are its primary cellular localizations?

YIPF2 is a mammalian homolog of the yeast Yif1p protein belonging to the Yip domain family. Immunofluorescence staining studies have demonstrated that YIPF2 primarily localizes in the medial-/trans-Golgi apparatus and partially in the trans-Golgi network (TGN) . The protein contains a Yip domain which is characteristic of proteins involved in membrane trafficking between the endoplasmic reticulum and Golgi apparatus.

To determine the precise localization of YIPF2, researchers typically perform immunofluorescence co-staining with established Golgi markers. When cells are treated with brefeldin A (BFA), YIPF2 co-migrates partially with medial-/trans-Golgi markers and TGN markers in the early stages, but eventually redistributes to distinct cytoplasmic punctate structures . This redistribution pattern is a key characteristic that helps differentiate YIPF2 from other Golgi-resident proteins in experimental settings.

What protein complexes does YIPF2 form and with which partners?

YIPF2 forms stable complexes with YIPF6, which is a homolog of yeast Yip1p. Research has shown that YIPF6 can separately form complexes with both YIPF1 and YIPF2 . These interactions appear to be crucial for the stable expression and proper localization of these proteins within the Golgi apparatus.

Experimental approaches to studying these interactions include:

  • Co-immunoprecipitation assays to detect protein-protein interactions

  • Knockdown experiments using siRNA to assess dependency relationships

  • Immunofluorescence co-localization studies to visualize protein complexes in situ

Knockdown experiments have revealed an asymmetric dependency relationship: while YIPF6 knockdown reduces YIPF1 and YIPF2 levels, the knockdown of YIPF1 and YIPF2 does not significantly affect YIPF6 expression or localization . This suggests YIPF6 plays a critical role in stabilizing these protein complexes.

What are the basic methods for detecting and quantifying YIPF2 expression in experimental systems?

For researchers working with YIPF2, several validated experimental approaches are available for detection and quantification:

  • Western Blotting: Using specific antibodies such as rabbit polyclonal anti-YIPF2 antibodies to detect protein expression levels in cell lysates.

  • Immunofluorescence: For visualizing the localization pattern of YIPF2 within cellular compartments, particularly in relation to Golgi markers.

  • qRT-PCR: For quantifying YIPF2 mRNA expression levels in various tissues or under different experimental conditions.

  • Recombinant Protein Expression: Expression systems using E. coli can produce recombinant YIPF2 protein with fusion tags (e.g., N-terminal His6-ABP tag) for use as standards or in functional assays .

When working with recombinant YIPF2, researchers should note that the protein is typically purified by IMAC chromatography and may be formulated in PBS with 1M Urea at pH 7.4 . For optimal results, it should be stored at -20°C, and freeze-thaw cycles should be avoided to maintain protein integrity.

How does YIPF2 function as a Rab-GDF and what is its role in vesicular trafficking?

YIPF2 has been identified as a novel Rab-GDF (GDI-displacement factor) that regulates vesicular trafficking through interaction with Rab GTPases. The protein plays a critical role in three independent trafficking steps:

  • Recruitment and activation of Rab5 and Rab22a GTPases to endomembrane structures

  • Modulation of endocytic recycling through distinctive regulation of Rab5 and Rab22a

  • Mediation of protein mature processing via the ER-Golgi trafficking route

Methodologically, the GTPase activation function of YIPF2 can be assessed using GST-RBD pull-down assays, which detect the active, GTP-bound forms of Rab proteins . Confocal imaging, flow cytometry, and biotin-labeled chase assays are commonly employed to measure the trafficking and recycling of proteins like CD147 that are regulated by YIPF2.

Research findings indicate that YIPF2 is particularly important for the trafficking of CD147, a glycoprotein highly upregulated in hepatocellular carcinoma (HCC). Decreased YIPF2 expression leads to efficient delivery of CD147 to the cell surface, which promotes matrix metalloproteinase (MMP) secretion and enhances malignant phenotypes in HCC cells .

What is the role of YIPF2 in glycosylation and how does this impact cellular functions?

YIPF2 plays a significant role in supporting normal glycan synthesis. Knockdown experiments have shown that depletion of YIPF1 and YIPF2, but not YIPF6, reduces intracellular glycan levels in HT-29 cells . This suggests that YIPF2 is involved in the machinery that facilitates proper protein glycosylation, which is essential for numerous cellular processes.

The impact of YIPF2 on glycosylation can be studied through:

  • Lectin binding assays to detect changes in glycan patterns

  • Mass spectrometry to analyze glycan structures

  • Pulse-chase experiments to track glycoprotein maturation

The connection between YIPF2-mediated glycosylation and cellular functions is particularly evident in cancer cells. For instance, in HCC, YIPF2 impacts the glycosylation status of CD147, which in turn affects cell adhesion, motility, migration, and invasion behaviors . These findings highlight how alterations in YIPF2 expression can have far-reaching consequences on cellular phenotypes through its effects on protein glycosylation.

What are the mechanisms by which YIPF2 regulates genome integrity?

A surprising recent discovery reveals that YIPF2, despite being primarily a Golgi protein, plays a critical role in maintaining genome stability. Research has shown that YIPF2 is involved in homologous recombination (HR) repair mechanisms, which are essential for repairing DNA double-strand breaks .

The depletion of YIPF2 has been found to:

  • Hinder the process of homologous recombination repair

  • Trigger DNA damage response mechanisms

  • Ultimately lead to cellular senescence

This unexpected connection between a Golgi protein and DNA repair highlights the complex interrelationships between different cellular compartments. Methodologically, researchers investigating this aspect of YIPF2 function typically employ:

  • Comet assays to detect DNA damage

  • Immunofluorescence for DNA damage markers (γ-H2AX)

  • HR reporter assays to assess homologous recombination efficiency

  • Senescence-associated β-galactosidase (SA-β-gal) staining to detect cellular senescence

Conversely, overexpression of YIPF2 has been shown to facilitate cellular recovery from DNA damage induced by chemotherapy agents or replicative senescence-associated DNA damage . This suggests potential therapeutic applications in contexts where DNA damage repair is compromised.

What is the relationship between YIPF2 expression and cancer progression?

YIPF2 has emerged as a significant factor in cancer biology, particularly in hepatocellular carcinoma (HCC). Studies have revealed that YIPF2 correlates and co-expresses with CD147, a glycoprotein highly upregulated in HCC, and serves as a survival predictor for HCC patients .

The relationship between YIPF2 and cancer progression appears complex:

  • YIPF2 acts as a critical regulator of CD147 glycosylation and trafficking in HCC cells

  • Decreased YIPF2 expression enhances the delivery of CD147 to the cell surface

  • This increased surface expression of CD147 promotes MMP secretion

  • The resulting elevated MMP activity enhances cancer cell adhesion, motility, migration, and invasion

To investigate the relationship between YIPF2 and cancer progression, researchers employ various methodologies:

  • Gene expression profiling interactive analysis (GEPIA) to examine co-expression patterns

  • Gelatin zymography to measure MMP activity

  • Cell adhesion, proliferation, migration, and invasion assays to assess malignant phenotypes

  • Biotin-labeled chase assays to track protein trafficking

These findings suggest that modulating YIPF2 expression could potentially provide a novel therapeutic approach for cancers characterized by dysregulated protein trafficking and elevated surface expression of oncogenic proteins.

What experimental approaches are used to study YIPF2's role in Golgi apparatus reassembly?

The role of YIPF2 in Golgi apparatus dynamics, particularly in reassembly following disassembly, represents an important area of research. Studies have shown that knockdown of YIPF1 and YIPF2, but not YIPF6, markedly delays the reassembly of the Golgi apparatus after the removal of brefeldin A (BFA) .

To study this function of YIPF2, researchers typically employ the following experimental approaches:

  • BFA treatment and washout experiments to induce Golgi disassembly and reassembly

  • Time-course imaging to track Golgi reassembly kinetics

  • siRNA-mediated knockdown to assess the effects of YIPF2 depletion

  • Co-localization studies with Golgi markers to visualize structural changes

Research findings suggest that free YIPF6 (that is not in complex with YIPF1 and YIPF2) interferes with the reassembly of the Golgi apparatus . This indicates that the balance between free and complexed Yip domain family proteins is crucial for normal Golgi dynamics.

How are mutations in YIPF2 linked to neurological disorders like Charcot-Marie-Tooth Disease?

YIPF2 has been associated with Charcot-Marie-Tooth Disease, Axonal, Type 2Z (CMT2Z), a neurological disorder characterized by progressive distal muscle weakness and atrophy . The mechanisms linking YIPF2 mutations to this disease likely involve disruptions in protein trafficking and Golgi function in neurons.

Methodological approaches to studying YIPF2 in the context of neurological disorders include:

  • Genetic screening for YIPF2 mutations in affected individuals

  • Generation of disease-specific induced pluripotent stem cells (iPSCs)

  • Differentiation of iPSCs into neurons to study cellular phenotypes

  • Development of transgenic animal models with YIPF2 mutations

Understanding the precise mechanisms by which YIPF2 mutations contribute to neurological disorders requires integrating molecular, cellular, and physiological approaches. This research may ultimately lead to targeted therapeutic strategies for patients with Charcot-Marie-Tooth Disease and related conditions.

What therapeutic potential does YIPF2 modulation offer for DNA damage-related conditions?

Recent findings that YIPF2 plays a role in maintaining genome integrity through homologous recombination repair mechanisms suggest potential therapeutic applications. Specifically, the observation that YIPF2 overexpression facilitates cellular recovery from DNA damage induced by chemotherapy agents or replicative senescence points to possible interventions for conditions characterized by DNA damage.

Potential therapeutic applications being explored include:

  • Enhancing YIPF2 expression to counteract cellular senescence in age-related conditions

  • Modulating YIPF2 activity to improve DNA repair in contexts of genotoxic stress

  • Using YIPF2 as a biomarker for predicting responses to DNA-damaging chemotherapeutics

The unexpected finding that "only the intact Golgi apparatus containing YIPF2 provides a protective effect on genome integrity" highlights the importance of considering organelle integrity in the development of strategies targeting DNA damage repair pathways.

What are the optimal conditions for producing and purifying recombinant YIPF2 protein?

For researchers working with recombinant YIPF2 protein, optimizing production and purification conditions is crucial for obtaining functional protein. Based on established protocols, E. coli expression systems have been successfully used to produce recombinant YIPF2 with N-terminal His6-ABP tags .

Key considerations for YIPF2 production and purification include:

  • Expression system: E. coli is commonly used, but mammalian or insect cell systems may be preferable for certain applications

  • Purification method: IMAC chromatography is effective for His-tagged YIPF2

  • Buffer composition: PBS with 1M Urea at pH 7.4 has been used successfully

  • Storage conditions: -20°C is recommended, with minimization of freeze-thaw cycles

Researchers should note that the formulation lacks preservatives, which may affect stability during long-term storage. The expected concentration for purified recombinant YIPF2 is typically greater than 0.5 mg/ml .

What controls should be included when studying YIPF2 knockdown or overexpression?

When designing experiments involving YIPF2 knockdown or overexpression, appropriate controls are essential for reliable interpretation of results. Based on published research, the following controls should be considered:

For knockdown experiments:

  • Non-targeting siRNA or shRNA controls

  • Rescue experiments with siRNA-resistant YIPF2 constructs

  • Assessment of other YIPF family proteins (especially YIPF1 and YIPF6) to control for off-target effects

  • Validation of knockdown efficiency at both mRNA and protein levels

For overexpression experiments:

  • Empty vector controls

  • Expression of unrelated proteins of similar size

  • Titration of expression levels to avoid artifacts from excessive overexpression

  • Assessment of subcellular localization to confirm proper trafficking of overexpressed protein

When studying YIPF2 in the context of Golgi reassembly, BFA treatment experiments should include time-course controls to account for variations in reassembly kinetics between different cell types .

What are the emerging areas of research regarding YIPF2's function beyond the Golgi apparatus?

The discovery of YIPF2's role in genome integrity maintenance has opened new avenues for research beyond its established functions in the Golgi apparatus. Emerging research areas include:

  • Investigation of potential nuclear localization or nuclear-associated functions of YIPF2

  • Exploration of signaling pathways connecting Golgi function to DNA repair mechanisms

  • Examination of YIPF2's role in cellular stress responses and adaptation

  • Analysis of potential roles in organizing membraneless organelles or phase separations

These new research directions challenge traditional organelle-based classifications of protein functions and suggest more complex interconnections between cellular compartments than previously appreciated.

How might high-throughput approaches advance our understanding of YIPF2 interactions and functions?

High-throughput approaches offer powerful tools for comprehensively mapping YIPF2's interactions and functions across different cellular contexts. Promising methodologies include:

  • Proximity labeling techniques (BioID, APEX) to identify the YIPF2 interactome in living cells

  • CRISPR screens to identify synthetic lethal or genetic interactions of YIPF2

  • Phosphoproteomics to map post-translational modifications and regulatory mechanisms

  • Single-cell RNA-seq to characterize cell type-specific functions of YIPF2

These approaches could reveal unexpected functions and interactions of YIPF2, particularly in disease contexts where traditional hypothesis-driven research might miss important connections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.