Recombinant Human Protein YIPF4 (YIPF4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YIPF4; Nbla11189; Protein YIPF4; YIP1 family member 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-113
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
YIPF4
Target Protein Sequence
MQPPGPPPAYAPTNGDFTFVSSADAEDLSGSIASPDVKLNLGGDFIKESTATTFLRQRGY GWLLEVEDD DPEDNKPLLEELDIDLKDIYYKIRCVLMPMPSLGFNRQVVRDNP
Uniprot No.

Target Background

Function

YIPF4 plays a role in maintaining Golgi apparatus structure.

Gene References Into Functions
  1. RNA interference studies demonstrated the importance of YIPF4 in maintaining Golgi morphology, revealing specific morphological changes upon its depletion. PMID: 27999994
  2. YIPF4 interacts with papillomavirus E5 proteins. PMID: 26235900
  3. Western blotting revealed YIPF4 as a single band consistent with its predicted molecular weight, while YIPF3 showed three distinct bands. PMID: 21757827
Database Links

HGNC: 28145

OMIM: 617534

KEGG: hsa:84272

STRING: 9606.ENSP00000238831

UniGene: Hs.468099

Protein Families
YIP1 family
Subcellular Location
Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in keratinocytes (at protein level).

Q&A

What is the basic structure and localization of YIPF4?

YIPF4 is a five-pass transmembrane Golgi-resident protein that predominantly localizes to the Golgi apparatus. Structurally, it contains multiple transmembrane domains that anchor it to the Golgi membrane . When expressed with fluorescent tags such as EGFP, YIPF4 displays a juxtanuclear ribbon-like pattern characteristic of Golgi proteins, colocalizing with established Golgi markers including GM130 (cis-Golgi), MAN2A1 (medial-Golgi), and TMEM165 (trans-Golgi) .

To validate the membrane association of YIPF4, cell fractionation studies have confirmed that both endogenous and epitope-tagged YIPF4 localize exclusively to the membranous fraction rather than the soluble cytoplasmic fraction . This membrane integration is essential for its function in Golgi organization and autophagy-related processes.

What is the primary function of YIPF4 in cellular processes?

YIPF4 functions primarily as part of a Golgiphagy receptor complex with YIPF3. This complex mediates the selective autophagic degradation of Golgi apparatus components during nutrient stress and cellular differentiation processes . The YIPF3-YIPF4 complex binds to autophagy-related 8 (ATG8) family proteins including LC3B, GABARAP, and GABARAPL1 through a LC3-interacting region (LIR) motif present in YIPF3 .

During starvation conditions, YIPF4 and its partner YIPF3 form punctate structures that colocalize with autophagosomal marker LC3 and lysosomal marker LAMP1, indicating their recruitment to autophagosomes for subsequent delivery to lysosomes . This process is dependent on core autophagy machinery components like FIP200 and VPS34, confirming its role in canonical autophagy pathways .

How does YIPF4 relate to other Golgi proteins and organelle maintenance?

Interestingly, expression of YIPF3 with a mutated LIR motif results in an elongated Golgi morphology, highlighting the importance of the YIPF3-YIPF4 complex in maintaining normal Golgi structure through selective autophagy . YIPF4 also appears to stabilize YIPF3, as deletion of YIPF4 suppresses YIPF3 levels, resulting in the loss of both proteins .

What are the recommended methods for expressing and purifying recombinant YIPF4?

For recombinant expression of YIPF4, several approaches have proven successful in research settings:

Mammalian Expression Systems:

  • Transient transfection of HEK293T cells with YIPF4-encoding plasmids containing appropriate tags (FLAG, EGFP, or mNEON) for detection and purification.

  • Creation of stable cell lines using lentiviral transduction followed by antibiotic selection to ensure consistent expression levels.

Purification Protocol:

  • Harvest cells and lyse in detergent-containing buffer (typically 1% Triton X-100 or NP-40 in PBS with protease inhibitors).

  • Perform membrane fractionation by ultracentrifugation to isolate membrane-associated proteins.

  • Solubilize membrane fraction with stronger detergents (DDM or CHAPS at 0.5-1%).

  • Utilize affinity chromatography with anti-tag antibodies conjugated to sepharose or magnetic beads.

  • Elute with competitive peptides or low pH buffer depending on tag system used.

When working with YIPF4, it's critical to maintain the integrity of its transmembrane domains during purification. Complete solubilization of membrane proteins requires optimization of detergent type and concentration while preserving protein structure and function .

How can researchers effectively detect and localize YIPF4 in cellular systems?

Several validated methods exist for detecting YIPF4:

Immunoblotting:

  • Use denaturing SDS-PAGE with 10-12% polyacrylamide gels.

  • Transfer to PVDF membranes at 100V for 60-90 minutes.

  • Block with 5% non-fat milk or BSA in TBST.

  • Probe with validated anti-YIPF4 antibodies or anti-tag antibodies for recombinant versions.

Immunofluorescence:

  • Fix cells with 4% paraformaldehyde for 15 minutes at room temperature.

  • Permeabilize with 0.1% Triton X-100 for 5 minutes.

  • Block with 3% BSA in PBS for 30 minutes.

  • Incubate with primary antibodies against YIPF4 and Golgi markers (GM130, MAN2A1, or TMEM165).

  • Visualize using fluorescently-labeled secondary antibodies.

For live-cell imaging, EGFP-YIPF4 or mNEON-YIPF4 fusion proteins allow real-time monitoring of YIPF4 dynamics, particularly during starvation-induced autophagy . Colocalization studies with mCherry-tagged Golgi markers provide additional validation of proper localization.

What reporter systems are available for studying YIPF4-mediated Golgiphagy?

Two specialized reporter systems have been developed to study YIPF4-mediated Golgiphagy:

1. mRFP-EGFP-Golgi Reporter System:
This tandem fluorescent tag system exploits the differential sensitivity of mRFP and EGFP to lysosomal pH. Before fusion with lysosomes, Golgi fragments show both mRFP and EGFP signals. After fusion with acidic lysosomes, the EGFP signal is quenched while mRFP remains stable, resulting in mRFP-only puncta that indicate successful delivery to lysosomes .

Implementation Protocol:

  • Establish stable cell lines expressing mRFP-EGFP-tagged Golgi proteins.

  • Induce autophagy through starvation (EBSS medium for 3-6 hours).

  • Quantify the ratio of mRFP-only puncta (successful Golgiphagy) to total puncta.

  • Compare between wild-type and YIPF4-depleted cells to assess YIPF4 dependency.

2. Proteomic Quantification of Golgi Protein Turnover:
This approach uses quantitative proteomics to measure the accumulation of Golgi proteins in autophagy-deficient cells compared to controls .

Implementation Protocol:

  • Generate YIPF4-knockout cell lines using CRISPR-Cas9.

  • Perform stable isotope labeling with amino acids in cell culture (SILAC) or tandem mass tag (TMT) labeling.

  • Subject cells to nutrient stress conditions.

  • Isolate Golgi fractions and perform LC-MS/MS analysis.

  • Identify Golgi proteins that accumulate in YIPF4-deficient cells .

Both systems have demonstrated that YIPF3 and YIPF4 are required for efficient Golgiphagy, as their deletion significantly reduces autophagy-dependent Golgi protein turnover .

How does the YIPF3-YIPF4 complex interact with the autophagy machinery?

The YIPF3-YIPF4 complex engages with the autophagy machinery through specific molecular interactions:

LIR Motif Interactions:
YIPF3 contains a conserved LC3-interacting region (LIR) motif that directly binds to ATG8 family proteins including LC3B, GABARAP, and GABARAPL1 . This interaction is essential for recruiting autophagosomes to Golgi fragments marked for degradation. The functional sequence of this interaction involves:

  • YIPF3's LIR motif binds to LC3/GABARAP proteins on forming autophagosomes.

  • The YIPF3-YIPF4 complex, embedded in Golgi membranes, serves as a receptor.

  • Autophagosomes engulf the Golgi fragments containing YIPF3-YIPF4.

  • The resulting autophagosomes fuse with lysosomes for degradation .

Regulatory Phosphorylation:
Interestingly, the YIPF3 LIR motif is regulated by putative phosphorylation sites immediately upstream of the motif. These sites are identical to those found in TEX264 (a major ER-phagy receptor), suggesting evolutionary conservation of this regulatory mechanism across different selective autophagy pathways . Phosphorylation of these sites likely enhances the binding affinity between YIPF3 and ATG8 proteins, similar to the regulation observed in other autophagy receptors.

What triggers YIPF4-mediated Golgiphagy under different cellular conditions?

YIPF4-mediated Golgiphagy responds to specific cellular triggers:

Nutrient Stress Response:
Under starvation conditions, YIPF4 and YIPF3 form punctate structures that colocalize with autophagosomes and lysosomes, indicating active Golgiphagy . This process appears to be part of a cellular adaptation mechanism that prioritizes the degradation of specific organelles, including the Golgi apparatus, during nutrient limitation. Specifically, amino acid starvation (typically induced by EBSS medium) triggers this response within 3-6 hours .

Cellular Differentiation:
Beyond stress responses, YIPF4-mediated Golgiphagy plays a role in developmental processes. During neuronal differentiation of human embryonic stem cells, YIPF4 contributes to Golgi remodeling . Cells lacking YIPF4 exhibit abnormal accumulation of Golgi membrane proteins during differentiation, comparable to the defects observed in ATG12-deficient neurons. This suggests that YIPF4-dependent Golgi remodeling is integral to proper cellular differentiation and development .

Interestingly, this process does not appear to require ubiquitylation, as treatment with the E1 ubiquitin-activating enzyme inhibitor TAK243 does not affect starvation-triggered formation of YIPF4 puncta . This distinguishes YIPF4-mediated Golgiphagy from some other selective autophagy pathways that depend on ubiquitin signaling.

How does YIPF4 differ from other autophagy receptors like CALCOCO1?

YIPF4 exhibits distinct characteristics compared to other known autophagy receptors:

Structural Differences:
Unlike soluble autophagy receptors such as CALCOCO1, YIPF4 is a transmembrane protein directly embedded in the Golgi membrane . This structural difference suggests a fundamentally different mechanism of action:

CharacteristicYIPF4CALCOCO1
LocalizationIntegral Golgi membrane proteinPrimarily soluble, with small fraction Golgi-associated
Binding PartnersForms complex with YIPF3Binds to ZDHHC17 (Golgi palmitoyl-transferase)
Effect on GolgiDepletion does not significantly affect Golgi morphologyDepletion results in Golgi expansion
MechanismDirect receptor function via YIPF3's LIR motifIndirect binding via ZDHHC17

These differences highlight the complexity of Golgi quality control mechanisms and suggest that multiple parallel pathways exist for selective autophagy of Golgi components, each with distinct molecular mechanisms and physiological roles .

How can YIPF4 knockout models be effectively generated and validated?

Creating reliable YIPF4 knockout models requires careful consideration of several factors:

CRISPR-Cas9 System Optimization:

  • Design multiple sgRNAs targeting early exons of the YIPF4 gene to maximize disruption probability.

  • Target conserved regions essential for protein function, particularly transmembrane domains.

  • Screen for complete knockouts using Western blotting, as partial knockdowns may retain residual function.

  • Consider potential off-target effects by performing whole-genome sequencing or targeted sequencing of predicted off-target sites.

Validation Protocol:

  • Confirm gene disruption at the DNA level by sequencing the targeted locus.

  • Verify absence of protein expression by Western blotting using antibodies targeting different epitopes.

  • Assess impact on YIPF3 expression, as YIPF4 knockouts typically show reduced YIPF3 levels .

  • Perform rescue experiments by reintroducing wild-type YIPF4 to confirm phenotypes are specifically due to YIPF4 loss.

  • Utilize Golgiphagy reporters (mRFP-EGFP-Golgi) to confirm functional defects in autophagy-dependent Golgi turnover .

Importantly, researchers should note that YIPF4 knockout suppresses YIPF3 levels, resulting in the loss of both proteins . This interdependence means that phenotypes observed in YIPF4 knockout models may result from the combined loss of both proteins, necessitating careful interpretation of results.

What are the implications of YIPF4's role in viral infections and potential therapeutic applications?

YIPF4 has been identified as a cellular binding partner for viral proteins, suggesting implications for viral pathogenesis:

HPV E5 Protein Interaction:
YIPF4 was discovered as a novel binding partner of the human papillomavirus (HPV) 16E5 protein through yeast two-hybrid screening . This interaction has been confirmed in cervical cells, and YIPF4 appears to be a common binding partner across different E5 proteins, suggesting a conserved function in viral infection .

Research Implications:

  • Investigate whether YIPF4-mediated Golgiphagy plays a role in viral evasion of host immune responses.

  • Examine if viral proteins like HPV E5 manipulate YIPF4 function to alter cellular membrane trafficking.

  • Consider YIPF4 as a potential target for antiviral strategies, particularly for viruses that interact with or depend on Golgi functions.

While current evidence does not support a direct role for YIPF4 in mediating the known functions of HPV E5, the conservation of this interaction across E5 proteins suggests it may be involved in an uncharacterized aspect of viral biology . Further research using YIPF4 knockout models in the context of viral infection could provide valuable insights into these potential functions.

How can proteomics approaches be optimized to study YIPF4-dependent Golgi protein turnover?

Advanced proteomics approaches offer powerful tools for investigating YIPF4's role in Golgi protein turnover:

Quantitative Proteomics Strategy:

  • Experimental Design: Compare protein abundance in wild-type vs. YIPF4-knockout cells under both normal and starvation conditions using SILAC, TMT, or label-free quantification.

  • Subcellular Fractionation: Enrich for Golgi membranes using density gradient centrifugation to increase detection sensitivity for low-abundance Golgi proteins.

  • Temporal Analysis: Implement pulse-chase proteomics (using dynamic SILAC) to measure protein turnover rates rather than steady-state levels.

  • Parallel Analysis: Compare YIPF4-KO with ATG5-KO or ATG7-KO cells to distinguish general autophagy effects from YIPF4-specific effects .

Data Analysis Considerations:

  • Implement rigorous statistical methods with appropriate multiple testing corrections.

  • Utilize pathway enrichment and protein interaction networks to identify functional clusters among YIPF4-regulated proteins.

  • Cross-reference identified proteins with Golgi proteome databases to verify subcellular localization.

Research has demonstrated that quantitative proteomic analysis can successfully identify Golgi-resident transmembrane proteins that accumulate in autophagy-deficient tissues and YIPF4-knockout cells . This approach revealed that YIPF4 ranked 7th among proteins enriched in proximity biotinylation experiments with autophagy proteins, and was the highest-ranked Golgi protein in these assays .

What are common challenges when working with recombinant YIPF4 and how can they be addressed?

Researchers working with recombinant YIPF4 frequently encounter several challenges:

Expression and Solubility Issues:
As a multi-pass transmembrane protein, YIPF4 can be difficult to express and solubilize in functional form.

ChallengeSolution
Low expression levelsUse strong promoters (CMV for mammalian cells) and optimize codon usage for expression system
Protein aggregationAdd chemical chaperones (glycerol, trehalose) to expression and purification buffers
Poor membrane integrationEnsure signal sequences are intact; consider using specialized membrane protein expression systems
Difficulty in solubilizationTest multiple detergents (DDM, CHAPS, digitonin) at various concentrations; use mild solubilization conditions (4°C, gentle agitation)

Preservation of Protein-Protein Interactions:
The functional YIPF3-YIPF4 complex is essential for biological activity, making it important to preserve this interaction.

  • Consider co-expression of YIPF3 and YIPF4 to maintain the complex.

  • Utilize gentle crosslinking (DSP, formaldehyde) to stabilize protein complexes before purification.

  • Implement native PAGE or blue native PAGE to analyze intact complexes.

  • For interaction studies, prefer pull-down approaches over far-Western techniques that may disrupt native conformations .

Functional Assays:
When assessing YIPF4 function in Golgiphagy, consider the interdependence with YIPF3:

  • Always assess YIPF3 levels when manipulating YIPF4 expression.

  • Include appropriate controls for autophagy inhibition (Bafilomycin A1) to distinguish changes in autophagy flux from changes in protein expression.

  • Use multiple methodologies (fluorescence microscopy, biochemical fractionation, proteomics) to validate findings .

How should researchers interpret conflicting results in YIPF4 functional studies?

When encountering conflicting results in YIPF4 studies, consider these methodological aspects:

Cell Type-Specific Effects:
YIPF4 function may vary between cell types. For example, while YIPF4 depletion doesn't affect HPV protein expression in undifferentiated keratinocytes , it significantly impacts Golgi protein turnover during neuronal differentiation . Always consider:

  • The cellular context (primary cells vs. cell lines, differentiated vs. undifferentiated).

  • Tissue-specific expression levels of YIPF4 and YIPF3.

  • Different autophagy basal activity levels across cell types.

Experimental Conditions:
Different stress conditions may activate distinct pathways:

  • Acute vs. chronic starvation (3h vs. 24h) may yield different results.

  • Complete nutrient deprivation (EBSS) vs. selective starvation (glucose or amino acid withdrawal) might activate different responses.

  • Presence of autophagy modulators (Bafilomycin A1) can significantly impact interpretation of results .

Technical Considerations:

  • Antibody specificity - validate antibodies using knockout controls.

  • Knockdown efficiency - partial silencing may not phenocopy complete knockout.

  • Overexpression artifacts - excessive expression levels may cause mislocalization or non-physiological interactions.

  • Timing of analyses - transient vs. stable effects should be distinguished.

When conflicting results appear in the literature, systematic comparison of methodological differences often reveals the source of discrepancies. Consider replicating key experiments with standardized conditions to resolve contradictions .

What experimental design considerations are critical for studying YIPF4 in neuronal differentiation models?

Investigating YIPF4's role in neuronal differentiation requires specialized approaches:

Model System Selection:

  • Human embryonic stem (ES) cells provide a physiologically relevant system for studying YIPF4 during neuronal differentiation .

  • Consider using iPSC-derived neurons for patient-specific studies.

  • Neuroblastoma cell lines (SH-SY5Y) offer a simpler alternative but may not fully recapitulate differentiation processes.

Critical Experimental Design Elements:

  • Timeline Analysis: Assess YIPF4 expression and Golgi morphology at multiple time points during differentiation to capture dynamic changes.

  • Parallel Comparisons: Include wild-type, YIPF4-/-, and ATG12-/- neurons to distinguish autophagy-dependent from autophagy-independent effects .

  • Quantitative Metrics: Develop objective measures of Golgi morphology, protein accumulation, and differentiation progress.

  • Functional Readouts: Include electrophysiological measurements or synapse formation assays to link molecular changes to functional neuronal development.

Technical Approaches:

  • Use live-cell imaging with fluorescently tagged YIPF4 to track dynamic changes during differentiation.

  • Implement super-resolution microscopy to resolve Golgi subdomains and their remodeling during differentiation.

  • Combine proteomics and transcriptomics to correlate YIPF4-dependent protein changes with gene expression patterns during differentiation.

  • Consider single-cell approaches to capture heterogeneity in neural differentiation processes.

Research has shown that differentiation of YIPF4-/- human ES cells into neurons results in selective accumulation of Golgi membrane proteins comparable to that observed in ATG12-/- neurons, underscoring YIPF4's role in autophagy-mediated Golgi remodeling during cellular state changes . This finding suggests that YIPF4-mediated Golgiphagy may be particularly important during developmental processes that involve significant cellular remodeling.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.