Recombinant Human Protein YIPF5 (YIPF5)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Human Protein YIPF5 (YIPF5) is a laboratory-engineered form of the YIP1 domain family member 5 protein, a multi-pass transmembrane protein critical for intracellular membrane trafficking. Endogenous YIPF5 localizes to the endoplasmic reticulum (ER)-Golgi intermediate compartment (ERGIC) and regulates COPI-independent retrograde transport between the Golgi and ER . It also facilitates STING-mediated innate immune responses by promoting COPII-dependent trafficking of STING from the ER to the Golgi during DNA virus infection .

COPI-Independent Retrograde Transport

YIPF5 knockdown delays Shiga toxin transport from the Golgi to the ER but does not affect anterograde VSVG transport . Its N-terminal domain selectively inhibits COPI-independent retrograde movement of GFP-tagged galactosyltransferase (GT-GFP) .

STING Trafficking and Antiviral Immunity

YIPF5 interacts with STING and COPII components, enhancing TBK1/IRF3 recruitment to STING and promoting IFN-β production during DNA virus infection . Knockdown impairs HSV-1 antiviral responses but not RNA virus (e.g., VSV) resistance .

Golgi Structure Maintenance

YIPF5 stabilizes Golgi architecture by interacting with YIPF3 and Rab GTPases . Depletion disrupts Rab6 membrane association, impairing Golgi-to-ER vesicle tethering .

Interaction Network

YIPF5 collaborates with key trafficking and signaling proteins :

Interaction PartnerRoleAssociation Score
SEC24BCOPII vesicle component; facilitates ER-to-Golgi cargo transport0.942
RAB6ARegulates COPI-independent retrograde transport0.641
YIF1AER-Golgi transport; Yip family member0.996
STINGInnate immune signaling; recruits TBK1/IRF3Validated via co-IP

Expression Systems

Recombinant YIPF5 is produced in E. coli, yeast, baculovirus, or mammalian cells, with ≥85% purity (SDS-PAGE verified) . Common tags include His-ABP for affinity purification .

Research Applications

  • Antibody Validation: Used as a control fragment (e.g., PA5-65329) in WB/IHC to block endogenous signals .

  • Functional Studies: Investigates ER-Golgi transport mechanisms and Golgi structural integrity .

  • Therapeutic Screening: Explored for modulating STING-dependent antiviral responses .

Key Research Findings

  • Tagging Effects: GFP-tagged YIPF5 localizes to ER/ERES, while HA-tagged YIPF5 localizes to ERGIC, highlighting tag-dependent artifacts .

  • Proinsulin Transport: YIPF5 is required for proinsulin transport from ER to Golgi in pancreatic β-cells .

  • COPII Recruitment: YIPF5 bridges STING and COPII vesicles, enabling ER-to-Golgi trafficking during DNA sensing .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
YIPF5; FINGER5; YIP1A; PP12723; SB140; UNQ3123/PRO10275; Protein YIPF5; Five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 5; Smooth muscle cell-associated protein 5; SMAP-5; YIP1 family member 5; YPT-interacting protein 1 A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
YIPF5
Target Protein Sequence
MSGFENLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSQQGRFVPPDMMQPQQ PYTGQIYQPTQAYTPASPQPFYGNNFEDEPPLLEELGINFDHIWQKTLTVLHPLKVADGS IMNETDLAGPMVFCLAFGATLLLAGKIQFGYVYGISAIGCLGMFCLLNLMSMTGVSFGCV ASVLGYCLLPMILLSSFAVIFSLQGMVGIILTAGIIGWCSFSASKIFISALAMEGQQLLV AYPCALLYGVFALISVF
Uniprot No.

Target Background

Function
YIPF5 plays a role in the transport of molecules between the endoplasmic reticulum and Golgi apparatus.
Gene References Into Functions
  1. RNA interference studies have demonstrated the importance of YIPF5 protein in maintaining the morphology of the Golgi apparatus, revealing specific structural changes upon its depletion. PMID: 27999994
  2. We propose a model for intracellular Brucella replication that utilizes the host unfolded protein response and endoplasmic reticulum -derived vacuole formation mechanisms, both of which are dependent on Yip1A-mediated IRE1 activation. PMID: 25742138
  3. Research suggests that the ability of Yip1A to bind its known binding partners may be independent of its capacity to regulate ER whorl formation. PMID: 23342155
  4. Findings reveal a conserved Yip1A-mediated mechanism for ER membrane organization that may regulate cargo exit from the organelle. PMID: 20237155
  5. The highest level of expression was observed in coronary smooth muscle cells, where SMAP-5 gene expression was induced by transforming growth factor beta1, suggesting a potential role of this protein in inflammation. PMID: 15922870
  6. Human Yip1A (YIPF5) interacts with and localizes human Yif1 (YIF1A) to the Golgi apparatus. PMID: 15990086
  7. YIPF5 is not confined to Endoplasmic Reticulum exit sites but also localizes in the ER-Golgi intermediate compartment (ERGIC) and partially in the cis-Golgi at steady state. PMID: 18718466
  8. These results indicate that Yip1A participates in COPI-independent retrograde transport from the Golgi to the ER and regulates the membrane recruitment of Rab6. PMID: 19509059

Show More

Hide All

Database Links

HGNC: 24877

OMIM: 611483

KEGG: hsa:81555

STRING: 9606.ENSP00000274496

UniGene: Hs.372050

Protein Families
YIP1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle. Note=Enriched at the endoplasmic reticulum exit sites. Colocalizes with RAB1A. Incorporated into COPII-coated vesicles.
Tissue Specificity
Ubiquitously expressed. Highly expressed in coronary smooth muscles.

Q&A

What is YIPF5 and where is it localized in cells?

YIPF5 is a five-pass transmembrane protein that localizes primarily in the Golgi apparatus and the endoplasmic reticulum. It belongs to the YIP1 family of proteins and serves as an important component of the cellular trafficking machinery. Immunofluorescence studies using antibodies against YIPF5 have demonstrated its presence in the Golgi complex and vesicular structures throughout the cytoplasm . When visualized in cell lines such as U-2 OS cells, YIPF5 shows distinct patterns of localization to the nucleoplasm and vesicles, which is consistent with its role in the secretory pathway . This localization pattern is critical for its function in mediating protein transport between cellular compartments and maintaining the structural integrity of the Golgi apparatus.

What alternative names and identifiers are associated with YIPF5?

YIPF5 is known by multiple alternative names in the literature and databases, which can sometimes create confusion for researchers. The protein is variously referred to as:

  • YIP1A (YPT-interacting protein 1 A)

  • FINGER5 (Five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 5)

  • SB140

  • SMAP5 or SMAP-5 (Smooth muscle cell-associated protein 5)

  • PP12723

  • UNQ3123/PRO10275

For database annotations, YIPF5 may be identified with specific gene IDs that vary across species. This nomenclature diversity highlights the importance of cross-referencing identifiers when searching literature or ordering research reagents to ensure you're working with the correct protein.

What is the basic function of YIPF5 in cellular transport?

YIPF5 fundamentally functions as a mediator of transport between the endoplasmic reticulum and Golgi apparatus. It is involved in the organization and stability of Golgi structures, interacting with other proteins including YIPF3 to facilitate this function . YIPF5 participates in maintaining the structural integrity of the Golgi and influences the movement of proteins and lipids through the secretory pathway. In specialized cells such as pancreatic beta cells, YIPF5 plays a specific role in transporting proinsulin from the endoplasmic reticulum into the Golgi apparatus, which is essential for proper insulin production and secretion . This function underscores the importance of YIPF5 in secretory processes that are critical for cellular homeostasis and organismal physiology.

How does YIPF5 interact with other proteins to maintain Golgi structure?

YIPF5 forms functional complexes with several proteins to maintain Golgi structure and function. Particularly significant is its interaction with YIPF3, another member of the YIP1 family. Together, these proteins contribute to the organization and stability of Golgi compartments . The interaction network likely involves additional trafficking regulators, including Rab GTPases, which are known to associate with YIP family proteins. When studying these interactions, co-immunoprecipitation approaches using antibodies against YIPF5 can help identify binding partners.

The functional significance of these interactions becomes apparent in knockdown experiments - when YIPF5 is depleted, the Golgi apparatus often fragments and disperses, indicating that YIPF5-containing protein complexes serve as structural scaffolds for maintaining Golgi integrity. Advanced techniques such as proximity labeling (BioID or APEX) could be employed to identify the complete interactome of YIPF5 at the Golgi-ER interface, providing a more comprehensive understanding of how this protein contributes to organelle maintenance.

What is the specific role of YIPF5 in pancreatic beta cells and insulin secretion?

In pancreatic beta cells, YIPF5 performs a specialized function that is crucial for insulin biosynthesis. Research has demonstrated that YIPF5 is specifically required to transport proinsulin from the endoplasmic reticulum into the Golgi apparatus . This function represents a critical step in the insulin secretory pathway, as proinsulin must be properly transported to the Golgi where it undergoes further processing to become mature insulin before secretion.

The significance of this role is highlighted by studies examining disruptions to YIPF5 function in beta cells. When YIPF5 is depleted or dysfunctional, proinsulin accumulates in the endoplasmic reticulum rather than progressing through the secretory pathway, potentially leading to ER stress and impaired insulin secretion. These findings suggest that YIPF5 might represent an important factor in diseases characterized by beta cell dysfunction, such as certain forms of diabetes. Further research using conditional knockout models or beta cell-specific depletion of YIPF5 could provide additional insights into its role in insulin biosynthesis and secretion.

How conserved is YIPF5 across different species?

YIPF5 demonstrates remarkable evolutionary conservation across diverse species, suggesting its fundamental importance in eukaryotic cell biology. Based on the available recombinant protein products, YIPF5 has been identified and characterized in numerous organisms including:

  • Humans (Homo sapiens) - YIPF5

  • Mice (Mus musculus) - Yipf5

  • Rats (Rattus norvegicus) - Yipf5

  • Zebrafish (Danio rerio) - yipf5

  • Frogs (Xenopus laevis and Xenopus tropicalis) - yipf5

  • Primates (Macaca fascicularis, Pongo abelii) - YIPF5

  • Bovine (Bos taurus) - YIPF5

  • Cellular slime mold (Dictyostelium discoideum) - yipf5 homolog

This conservation extends from vertebrates to more distantly related eukaryotes, indicating that YIPF5 likely emerged early in eukaryotic evolution. Comparative sequence analysis between these homologs can provide insights into conserved domains and regions that are likely critical for YIPF5 function. The presence of YIPF5 in organisms as evolutionarily distant as slime molds and humans suggests that its role in ER-to-Golgi transport represents a fundamental and ancient cellular process.

What are the optimal methods for detecting YIPF5 in different experimental setups?

Multiple approaches exist for detecting YIPF5 in experimental systems, with the choice depending on specific research objectives. For protein localization studies, immunofluorescence using anti-YIPF5 antibodies provides excellent visualization of the protein's distribution within cells. The rabbit polyclonal antibody (ab220061) has been validated for immunocytochemistry/immunofluorescence (ICC/IF) applications in human samples . When performing immunofluorescence, paraformaldehyde fixation followed by Triton X-100 permeabilization works effectively, as demonstrated in U-2 OS cells where this protocol reveals YIPF5 localization to nucleoplasm and vesicles .

For protein expression analysis, Western blotting represents a standard approach. Multiple anti-YIPF5 antibodies are available with validation for this application . Additionally, ELISA assays can be employed using the various conjugated antibodies (FITC, Biotin, or HRP-conjugated) specifically designed for this technique .

When more sensitive detection is required, particularly for studying protein interactions, immunoprecipitation using high-affinity antibodies followed by mass spectrometry can provide comprehensive insights into YIPF5-associated protein complexes. For all these applications, appropriate controls are essential, including negative controls without primary antibody and positive controls using cell types known to express YIPF5.

What approaches are recommended for expressing and purifying recombinant YIPF5?

Several expression systems have been successfully employed for producing recombinant YIPF5, each with particular advantages depending on the experimental requirements. The available recombinant YIPF5 products indicate that both full-length and partial protein expressions are feasible .

For basic applications, cell-free expression systems provide a straightforward approach, yielding recombinant YIPF5 with ≥85% purity as determined by SDS-PAGE . This system offers rapid production without the complications of cellular toxicity that can arise when expressing membrane proteins.

For applications requiring higher yields or specific post-translational modifications, multiple heterologous expression systems have been validated for YIPF5:

  • E. coli expression systems (suitable for partial proteins or domains)

  • Yeast expression systems

  • Baculovirus expression systems

  • Mammalian cell expression systems

The choice among these systems depends on research objectives. For structural studies requiring large protein quantities, E. coli or yeast systems might be preferable. For functional studies where proper folding and modifications are critical, mammalian or baculovirus systems are recommended. Purification typically employs affinity chromatography using epitope tags, followed by size exclusion chromatography to achieve high purity. The final preparations consistently achieve ≥85% purity as assessed by SDS-PAGE .

What experimental designs are most effective for studying YIPF5 function?

To thoroughly investigate YIPF5 function, multi-faceted experimental approaches are recommended. Loss-of-function studies using RNA interference (siRNA or shRNA) or CRISPR-Cas9 gene editing provide insights into YIPF5's necessity for cellular processes. When designing such experiments, monitoring Golgi morphology and protein trafficking efficiency are critical readouts, as YIPF5 depletion typically results in Golgi fragmentation and transport defects.

For studying YIPF5's role in specific cell types like pancreatic beta cells, conditional knockout models or cell-specific depletion strategies are valuable. These approaches have revealed YIPF5's requirement for proinsulin transport from the endoplasmic reticulum to the Golgi . Complementary gain-of-function studies using overexpression of wild-type or mutant YIPF5 can further elucidate its mechanisms of action.

Live-cell imaging using fluorescently tagged YIPF5 enables real-time visualization of its dynamics within the secretory pathway. When combined with cargo trafficking assays (using reporter proteins like VSVG-GFP), such experiments can reveal YIPF5's precise contributions to transport processes. For interaction studies, proximity labeling techniques (BioID or APEX2) offer advantages over traditional co-immunoprecipitation by capturing transient or weak interactions in the native cellular environment.

How can researchers address common technical issues when working with YIPF5?

Membrane proteins like YIPF5 present several technical challenges that researchers should anticipate. When expressing recombinant YIPF5, toxicity can occur due to membrane disruption. This can be mitigated by using inducible expression systems or cell-free expression methods that have been validated for YIPF5 production with ≥85% purity .

For antibody-based detection, potential cross-reactivity with other YIP family members must be considered. Using antibodies that target unique regions of YIPF5 minimizes this risk. The commercially available rabbit polyclonal antibodies against YIPF5 have been validated for specificity in applications like immunofluorescence .

In localization studies, overexpression artifacts can occur where excessive YIPF5 disrupts normal Golgi morphology. To avoid this, titrating expression levels or using genome editing to tag endogenous YIPF5 is recommended. For functional studies, compensatory mechanisms may mask phenotypes in acute knockdown experiments. This can be addressed by analyzing rapid responses to depletion or using combinatorial knockdowns of YIPF5 with related proteins like YIPF3.

For interaction studies, the membrane environment of YIPF5 can complicate standard immunoprecipitation protocols. Using detergents that preserve protein-protein interactions while solubilizing membranes (such as digitonin or CHAPS) improves results. These technical considerations ensure more reliable data when investigating this biologically significant membrane protein.

How should researchers interpret YIPF5 experimental data in context?

Interpreting YIPF5 experimental data requires careful consideration of its multiple roles in cellular trafficking. When analyzing phenotypes resulting from YIPF5 manipulation, researchers should distinguish between direct effects on transport and secondary consequences of Golgi disruption. For instance, secretory defects might stem directly from YIPF5's role in ER-to-Golgi trafficking or indirectly from general Golgi disorganization.

In pancreatic beta cell studies, YIPF5's effect on proinsulin transport represents a cell type-specific function . Researchers should consider whether findings in beta cells generalize to other secretory cell types or represent specialized adaptations. The evolutionary conservation of YIPF5 across diverse species suggests fundamental importance, but potential species-specific functions should be considered when translating findings between model organisms.

For interaction studies, the transmembrane nature of YIPF5 means that some binding partners may associate indirectly through membrane microdomains rather than direct protein-protein contacts. Distinguishing these possibilities requires complementary approaches such as in vitro binding assays with purified components.

What are promising areas for advancing YIPF5 research?

Several promising research directions could significantly advance our understanding of YIPF5 biology. Structure-function studies using cryo-electron microscopy or X-ray crystallography would provide crucial insights into how YIPF5 interacts with membranes and partner proteins. The availability of purified recombinant YIPF5 from various expression systems facilitates such structural investigations .

Investigation of post-translational modifications regulating YIPF5 function represents another valuable direction. Phosphoproteomic approaches could identify regulatory modifications and the signaling pathways that control YIPF5 activity in response to cellular conditions.

The role of YIPF5 in disease contexts merits further exploration, particularly in conditions involving secretory pathway dysfunction. Its established role in proinsulin transport in beta cells suggests potential involvement in certain forms of diabetes. Single-cell transcriptomic analysis of disease tissues could reveal altered YIPF5 expression patterns correlated with pathology.

Comparative studies across multiple secretory cell types would determine whether YIPF5's role in proinsulin transport in beta cells reflects a specialized function or a general mechanism applicable to diverse cargo proteins. Finally, investigation of potential regulatory roles beyond structural maintenance—such as involvement in cargo selection or quality control—would provide a more complete picture of YIPF5's contributions to cellular physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.