Recombinant Human Proteinase-activated receptor 1 (F2R)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Proteinase-activated Receptor 1 (F2R)

Recombinant Human Proteinase-activated Receptor 1 (F2R), also designated as PAR1, is a member of the G protein-coupled receptor (GPCR) family critically involved in the regulation of thrombotic responses . This receptor belongs to a specialized subfamily of GPCRs known as protease-activated receptors (PARs) that are uniquely activated through proteolytic cleavage of their extracellular domain . F2R is the first identified member of the PAR family, which includes four mammalian receptors: PAR1 (encoded by F2R), PAR2 (encoded by F2RL1), PAR3 (encoded by F2RL2), and PAR4 (encoded by F2RL3) .

F2R demonstrates ubiquitous expression throughout the human body, with presence in at least 23 different tissues including the spleen and gallbladder . These receptors are highly expressed in platelets and also found on endothelial cells, fibroblasts, immune cells, myocytes, neurons, and tissues lining the gastrointestinal tract . With its multifaceted effects, F2R plays a crucial role in mediating the interplay between coagulation and inflammation and has been implicated in the pathogenesis of various diseases, including inflammatory and fibrotic lung conditions .

The recombinant form of human F2R protein is produced through genetic engineering techniques, typically using expression systems like E. coli, and often includes tags such as histidine (His) for purification purposes . This recombinant version enables detailed structural and functional studies that enhance our understanding of this important receptor.

Biological Functions of F2R

F2R serves as a high-affinity receptor for activated thrombin and couples to G proteins that stimulate phosphoinositide hydrolysis . The receptor's primary physiological role involves mediating cellular responses to thrombin and related proteases, particularly in the context of coagulation and inflammation.

The functional capabilities of F2R include:

  1. G-protein alpha-subunit binding

  2. G-protein beta-subunit binding

  3. G-protein coupled receptor activity

  4. Thrombin receptor activity

  5. Receptor binding

  6. Protein binding

These functions enable F2R to transduce extracellular signals across the cell membrane, triggering intracellular signaling cascades that regulate diverse cellular processes. The receptor plays a significant role in platelet activation, a critical step in blood clotting and hemostasis .

The following table outlines the various functions of F2R and related proteins that exhibit similar activities:

FunctionRelated Proteins
G-protein coupled receptor activityPTGER4B, OPRM1, GPR37B, GRIN1A, VMN1R43, VMN1R52, MRGPRD, FFAR3, TAAR12F, NTSR1
Receptor bindingPIPOX, ANXA1, CXCL10, NPPA, HAMP, NRG2, LAMA1, GBA, ABCA1, NPPB
Thrombin receptor activityF2RL2, GP1BA, F2RL1, F2RL1.1, F2RL1.2
G-protein alpha-subunit bindingNUCB1, OPRM1, DRD1, F2RL1, AGTR1A, RGS4, RGS14, LPAR3, ADRB2, RIC8B
Protein bindingICAM1, RMND5A, THG1L, ARHGDIA, CKS1B, CDK18, CHMP6, HOOK1, POP5, TXLNG
G-protein beta-subunit bindingGNG13, RASD2, RGS7, CCT5, RGS9, RGS11, GNG2, F2RL1, OPRM1

Through its diverse functional capabilities, F2R coordinates complex cellular responses to environmental stimuli, particularly those related to vascular injury, inflammation, and tissue repair processes.

Signaling Pathways Involving F2R

F2R participates in numerous signaling pathways that regulate critical cellular functions. Upon activation by thrombin or other proteases, F2R initiates signal transduction cascades that modulate various physiological and pathological processes.

The major signaling pathways involving F2R include:

  1. Rap signaling pathway

  2. Calcium signaling pathway

  3. Pathways in cancer

  4. cAMP signaling pathway

  5. Complement and coagulation cascades

  6. Neuroactive ligand-receptor interaction

  7. Platelet activation

  8. PIK-Akt signaling pathway

  9. Endocytosis

The following table illustrates selected pathways in which F2R participates and identifies other proteins involved in these same pathways:

Pathway NamePathway Related Proteins
Rap signaling pathwayMET, MAPK11, GNAQ, FGFR3, FYB, KRIT1, BRAF, VEGFB, SRC, PLCG1
Calcium signaling pathwayHTR2A, AVPR1A, CHRM2A, CACNA1B, HTR6, PDE1C, CALM1, TACR1B, ADORA2AA, PRKACA
Pathways in cancerCCDC6, PTCH1, GNB1, CCNA1, FGF7, BMP4, FGF21, ARNT2, BID, LAMB1
cAMP signaling pathwayVIPR2, CALML5, ATP1A3, LIPE, RAC2, HTR1B, PPARA, MAPK8, GRIA1, PTGER2
Complement and coagulation cascadesC2, FGA, PROC, SERPINA5, PLAT, PLG, MBL1, C3AR1, MASP1, C1QA

Recent research has revealed that F2R-related genes are associated with extracellular matrix (ECM) receptor interactions, neuroactive ligand-receptor interactions, the phosphoinositide-3-kinase-protein kinase B/Akt (PI3K-AKT) signaling pathway, the Wnt signaling pathway, and the transforming growth factor-beta (TGF-β) signaling pathway . Gene set enrichment analysis also demonstrated connections to DNA replication and the Janus kinase/signal transducers and activators of transcription (JAK-STAT) signaling pathway .

The involvement of F2R in these diverse signaling networks underscores its importance in cellular regulation and suggests multiple mechanisms through which it may contribute to disease pathogenesis when dysregulated.

Role in Disease Pathogenesis

F2R has been implicated in various pathological conditions, including cancer, inflammatory disorders, and autoimmune diseases. Emerging evidence suggests that aberrant expression or activation of F2R may contribute to disease development and progression.

F2R in Cancer

Recent bioinformatics analysis has identified F2R as a potential biomarker in gastric adenocarcinoma. Data from the Cancer Genome Atlas (TCGA) and Gene Expression Omnibus (GEO) databases revealed significantly elevated F2R expression in stomach adenocarcinoma (STAD) tissues compared to normal tissues . Patients with high F2R expression demonstrated shorter survival times than those with low expression, suggesting its potential value as a prognostic marker .

F2R expression was significantly correlated with multiple clinicopathological parameters, including tumor (T) stage, node (N) stage, histological grade, and pathological stage . These findings indicate that F2R may contribute to gastric cancer progression through mechanisms that remain to be fully elucidated.

F2R in Inflammatory and Autoimmune Diseases

F2R has been associated with the pathogenesis of inflammatory and fibrotic lung diseases, highlighting its crucial role in mediating the interplay between coagulation and inflammation . Recent research has also suggested a potential connection between F2R and systemic lupus erythematosus (SLE), an autoimmune disease characterized by systemic inflammation and tissue damage .

Drug sensitivity and molecular docking studies have identified F2R as a potential therapeutic target in SLE, suggesting that modulation of F2R activity might represent a novel approach for treating this challenging autoimmune condition .

The involvement of F2R in these diverse pathological processes underscores its significance as both a biomarker and a potential therapeutic target across multiple disease contexts.

Therapeutic Potential and Drug Interactions

F2R represents a promising target for therapeutic intervention in various diseases, particularly those involving dysregulated coagulation, inflammation, or cellular proliferation. Protease-activated receptors, including F2R, are important targets for drug development, and understanding their structure facilitates the development of improved antagonists .

Drug Sensitivity Analysis

Drug sensitivity analysis has revealed significant correlations between F2R and at least 25 distinct drugs or molecular compounds . This extensive interaction profile suggests that F2R-targeting approaches might offer multiple avenues for therapeutic intervention across different disease contexts.

Molecular Docking Studies

Molecular docking studies have identified two compounds with strong binding affinities for F2R:

  1. COMPOUND 22 [WO2019141694A1]

  2. N-(5-{4-CHLORO-3-[(2-HYDROXYETHYL) SULFAMOYL] PHENYL}-4-METHYL-1,3-THIAZOL-2-YL) ACETAMIDE

Both compounds demonstrated binding energies less than zero, indicating strong and stable interactions with the F2R protein . These findings suggest potential therapeutic applications targeting F2R, particularly in conditions like systemic lupus erythematosus where F2R dysregulation may contribute to disease pathogenesis.

The structural information available for F2R will aid in the development of improved PAR1 antagonists and facilitate the discovery of antagonists to other members of this receptor family . As research continues to uncover the complexities of F2R signaling and function, new therapeutic approaches targeting this receptor are likely to emerge.

Recent Research Developments

Recent advances in F2R research have expanded our understanding of its biological roles and therapeutic potential across multiple disease contexts. These developments have been facilitated by bioinformatics approaches, molecular techniques, and drug discovery efforts.

Bioinformatics Analysis in Cancer Research

A recent study employed comprehensive bioinformatics analysis to identify F2R as a critical factor in gastric adenocarcinoma . The researchers utilized stomach adenocarcinoma (STAD)-related gene microarray data and corresponding clinicopathological information from the Cancer Genome Atlas (TCGA) and Gene Expression Omnibus (GEO) databases .

Differential expression genes (DEGs) associated with F2R were analyzed using Gene Ontology (GO), Kyoto Encyclopedia of Genes and Genomes (KEGG), gene set enrichment analysis (GSEA), and protein-protein interaction (PPI) networks . F2R mRNA expression data were used to estimate stromal cell and immune cell scores in gastric cancer tissue samples, including stromal score, immune score, and ESTIMATE score .

Drug Discovery and Therapeutic Applications

Recent drug sensitivity and molecular docking studies have suggested F2R as a potential new therapeutic target for systemic lupus erythematosus . The identification of compounds with strong binding affinities for F2R represents a significant step toward developing targeted therapies for conditions involving F2R dysregulation.

These research developments highlight the continuing importance of F2R as both a subject of basic scientific investigation and a target for therapeutic intervention across multiple disease contexts.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will prepare the product according to your specifications.
Lead Time
Delivery times may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
F2R; CF2R; PAR1; TR; Proteinase-activated receptor 1; PAR-1; Coagulation factor II receptor; Thrombin receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
42-425
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
F2R
Target Protein Sequence
SFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWL TLFVPSVYTGVFVVSLPLNIMAIVVFILKMKVKKPAVVYMLHLATADVLFVSVLPFKISY YFSGSDWQFGSELCRFVTAAFYCNMYASILLMTVISIDRFLAVVYPMQSLSWRTLGRASF TCLAIWALAIAGVVPLLLKEQTIQVPGLNITTCHDVLNETLLEGYYAYYFSAFSAVFFFV PLIISTVCYVSIIRCLSSSAVANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLS HTSTTEAAYFAYLLCVCVSSISCCIDPLIYYYASSECQRYVYSILCCKESSDPSSYNSSG QLMASKMDTCSSNLNNSIYKKLLT
Uniprot No.

Target Background

Function
Proteinase-activated receptor 1 (PAR1), also known as F2R, is a high-affinity receptor for activated thrombin coupled to G proteins that stimulate phosphoinositide hydrolysis. PAR1 may play a role in platelet activation and vascular development.
Gene References Into Functions
  1. Knockdown of EPCR significantly reduced the activation of PAR-1 on the cell surface of SGC7901 and AGS cells. Conversely, blocking PAR-1 inhibited the proliferation and migration of gastric cells in vitro. PMID: 29484413
  2. Structural data revealed subtle variations in the binding pose between Vorapaxar and F16357. Transmembrane helices 1, 2, 5, and 7 were most significantly impacted, particularly a prominent kink at F279(5.47) in TM helix 5 of the Vorapaxar complex, which was absent in the F16357 complex. These findings facilitate the development of other therapeutic PAR1 antagonists. PMID: 28881236
  3. Utilizing a protein C-factor VII chimera, a study demonstrated that APC light chain amino acid residues outside the EPCR-binding site enable cytoprotective PAR1 signaling. PMID: 28834159
  4. A study indicated that nerve activation by mucosal biopsy supernatants relies on proteases. This is a common characteristic of quiescent ulcerative colitis and irritable bowel syndrome (IBS) and may relate to shared gastrointestinal symptoms. However, only proteases in IBS supernatants signal through PAR1. PMID: 29529042
  5. No significant correlation was found between the level of autoantibodies to coagulation factor II thrombin receptor (F2R; protease-activated receptor 1, PAR1) (PAR1-AB) and progression-free survival (PFS) or overall survival (OS). PMID: 29848718
  6. Activation of the protease-activated receptor 1 (PAR1) induced secretion of TSLP by the corneal stromal cells... it was suggested that TSLP might serve as the link between elevated protease activity and inflammatory responses or itch sensation in the PMID: 28631887
  7. PAR-1 in non-small-cell lung cancer is primarily expressed on cells comprising the pulmonary tumor microenvironment, including vascular endothelial cells, macrophages, and stromal fibroblasts. PMID: 28173772
  8. Thrombin binding to PAR-1 receptor activated the Gi-protein/c-Src/Pyk2/EGFR/PI3K/Akt/p42/p44 MAPK cascade, which in turn elicited AP-1 activation and ultimately evoked MMP-9 expression and cell migration in SK-N-SH cells. PMID: 27181591
  9. This study demonstrated that TGFbeta is a positive regulator of PAR-1 expression in A549 lung adenocarcinoma cells, which consequently increases the sensitivity of these cells to thrombin signaling. PMID: 27566553
  10. These results indicated that PAR1 signaling-mediated cJun activation promotes early apoptosis of HUVEC cells induced by heat stress. PMID: 28447716
  11. The DHA - naringenin hybrid presented triple antiplatelet activity concurrently targeting PAR-1, P2Y12, and COX-1 platelet activation pathways. PMID: 28844979
  12. Dabigatran enhances platelet reactivity by increasing the thrombin receptor density on platelets. PMID: 27992120
  13. Data suggest that the abrogation of protease-activated receptor 1 (PAR1)-dependent signaling pathways may offer a promising strategy for gliomas. PMID: 26616854
  14. These data indicate that KLKB1 induces inflammatory reactions in human dental tissues via protease-activated receptor 1. PMID: 26566265
  15. This study found upregulation of several hemostasis-related genes, including the thrombin-activatable receptor PAR-1 (protease-activated receptor-1), in Runx1/Cbfb-deleted MLL-AF9 cells. Similar to the effect of Runx1/Cbfb deletion, PAR-1 overexpression induced CDKN1A/p21 expression and attenuated proliferation in MLL-AF9 cells. PMID: 27819671
  16. Data highlight functional differences in proliferation and barrier integrity between dark keratinocytes and fair keratinocytes, partly attributed to their differential expression of PAR1 and PAR2. PMID: 27979585
  17. The contribution of PAR1 and PAR4 to thrombin-mediated activation of the platelet fibrin receptor (GPIIbIIIa) is reported. PMID: 27784794
  18. In a Cox regression model, fully adjusted for age, race, sex, BMI, and smoking status, carrying a T allele was not associated with major adverse cardiac events (MACE) (HR 1.19, 95% CI 0.89-1.59, P = 0.23) or bleeding (HR 0.73, 95% CI 0.37-1.4, P = 0.34). In conclusion, in this population, F2R IVS-14 PAR1 variability does not affect the risk of MACE or bleeding following percutaneous coronary intervention (PCI). PMID: 26446588
  19. These results suggest that stabilization of microtubule-unbound tau by phosphorylation at Ser262/356 via the PAR-1/MARK pathway may participate in the initial stages of tau mismetabolism in Alzheimer's disease (AD) pathogenesis. PMID: 27023670
  20. Serum levels of PAR1 might possess diagnostic value in lung cancer patients. PMID: 26875892
  21. HMGA2 (high mobility group A2) was identified as a crucial regulator of PAR1-mediated invasion. Inhibition of PAR1 signaling suppresses HMGA2-driven invasion in breast cancer cells. PMID: 26165842
  22. Thrombin and the PAR-1 activating peptide, TFLLR, lead to the phosphorylation of eNOS-Ser-1177 in human coronary artery endothelial cells, which was blocked by SCH-79797 (SCH), a PAR-1 inhibitor. PMID: 26729042
  23. Rab11A and Rab11B differentially regulate intracellular trafficking of PAR1 through distinct endosomal sorting mechanisms. PMID: 26635365
  24. FXa is established as a potentially significant asthma mediator, stimulating airway smooth muscle function through actions requiring PAR-1 and annexin A2 and involving integrin coactivation. PMID: 26120939
  25. The rs2227744A allele significantly associates with protection from sarcoidosis (P = 0.003, OR = 0.68 (0.52-0.88)). PMID: 26278396
  26. Binding of the PH domain of PAR-1 enables breast cancer growth and extravillous trophoblast invasion. PMID: 26600192
  27. PZ-128 is a promising antiplatelet agent that provides rapid, specific, dose-dependent, and reversible inhibition of platelet protease-activated receptor-1 through a novel intracellular mechanism. PMID: 26681756
  28. Bladder PAR activation elicits urothelial MIF release and urothelial MIF receptor signaling, at least partly through CXCR4, resulting in abdominal hypersensitivity without overt bladder inflammation. PMID: 26020638
  29. PAR1-platelet releasate enhances vasculogenesis more potently than PAR4-platelet releasate, and the enhancements require the cooperation of multiple platelet-derived angiogenic regulators. PMID: 25495701
  30. Conjugation of a peptide fragment derived from the third intracellular loop (i3) of the protease-activated receptor 1 (PAR1) to a peptide that can selectively target tumors. PMID: 26424552
  31. Platelet activation with a PAR1 agonist triggered TGF-beta secretion, which induced epithelial-mesenchymal transition (EMT) of via the downregulation of miR-200b expression. Activated platelets exhibited a chemotactic effect on colon cancer cells mediated by the upregulation of CXCR4. PMID: 25846512
  32. The data reveal a novel proprotein convertases -PAR-1-interaction pathway, which offsets the effects of HIV-induced neuroinflammation, viral infection, and potentially the development of HIV-Associated Neurocognitive Disorder. PMID: 26283733
  33. Protease activated receptor-1 deficiency diminishes bleomycin-induced skin fibrosis. PMID: 24842054
  34. Proteases found in dust derived from animal feed play a significant role in eliciting dust-mediated inflammatory responses, at least partially through activation of PAR1 and PAR2. PMID: 26092994
  35. Data show that N-linked glycosylation of protease-activated receptor-1 (PAR1) at extracellular loop 2 (ECL2) controls G12/13 versus Gq G-proteins coupling specificity in response to thrombin stimulation. PMID: 26100877
  36. Low levels impact placenta establishment and consequently pregnancy outcome. PMID: 25496845
  37. The i3 pepducin enhances PAR1/Galpha subunit interactions and induces a conformational change in fluorescently labeled PAR1 in a manner very similar to that induced by thrombin. PMID: 25934391
  38. Apixaban exerts anti-inflammatory effects in mesangial cells by blocking the thrombin/protease-activated receptor-1 system. PMID: 25294586
  39. Human PAR1, expressed at low levels in mouse platelets, is unresponsive to agonist peptides. PMID: 24830314
  40. Evidence against the hypothesis that PAR-1 and PAR-4 stimulation of platelets trigger differential release of alpha-granules. PMID: 24776597
  41. The upregulation of MMP-1 protein combined with the overexpression of PAR-1 protein may contribute to the malignant progression of prostate cancer. PMID: 24805876
  42. High protease-activated receptor-1 expression is associated with colorectal cancer. PMID: 25119598
  43. Tissue vascularization was found to be significantly increased in the compact tumor mass of glioblastomas compared to their invasion zone. Specific overexpression of PAR-1 was observed within tumor cells and within tumor blood vessels depending on the tumor area. PMID: 24620969
  44. Data indicate that proteinase-activated receptor 1 (PAR1) was prominently expressed in hematopoietic stem cells. PMID: 24740120
  45. Analysis of a P2Y12 receptor mutation and a function-reducing polymorphism in protease-activated receptor 1 in a patient with chronic bleeding [case report]. PMID: 24612435
  46. PAR-1 is post-transcriptionally regulated by miR-20b microRNA in human melanoma cells. PAR-1 was found to be expressed in metastatic melanoma cells but was barely detectable in primary melanoma. PMID: 24405508
  47. PAR-1 may play a significant role in the metastasis of lung giant cell carcinoma cells by up-regulating intracellular calcium. PMID: 20388375
  48. Activation of PAR-1 stimulates MMP-2 secretion, inhibits rheumatoid arthritis synovial fibroblasts growth and invasion, and decreases production of IL-17 and TNFalpha by them. PMID: 21905006
  49. PAR-1 plays a key role in melanoma progression. PAR-1 and its activating factors on tumor cells and the surrounding stroma induce coagulation and cell signaling, promoting the metastatic phenotype. Review. PMID: 22009534
  50. Our results also show that platelet PAI-1 is increased if incubated for 24 hours, both with the addition of PAR1-activating peptide and without activation, which could indicate de novo synthesis. PMID: 22283974

Show More

Hide All

Database Links

HGNC: 3537

OMIM: 187930

KEGG: hsa:2149

STRING: 9606.ENSP00000321326

UniGene: Hs.482562

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Platelets and vascular endothelial cells.

Q&A

What is Proteinase-activated Receptor 1 (F2R) and what are its primary functions?

Proteinase-activated Receptor 1 (F2R), also known as PAR1 or thrombin receptor, is a high-affinity G protein-coupled receptor that binds activated thrombin, leading to calcium release from intracellular stores. The thrombin-activated receptor signaling pathway operates through PTX-insensitive G proteins and activates phospholipase C, resulting in the production of 1D-myo-inositol 1,4,5-trisphosphate (InsP3). This binds to InsP3 receptors, causing calcium release from intracellular stores. PAR1 plays significant roles in platelet activation, vascular development, and mediating the up-regulation of pro-inflammatory cytokines like MCP-1/CCL2 and IL6 .

What is the sequence composition of commercially available Recombinant Human PAR1/Thrombin Receptor protein?

The commercially available Recombinant Human PAR1/Thrombin Receptor protein typically includes the human fragment protein in the 42 to 102 amino acid range. The specific sequence is: S F L L R N P N D K Y E P F W E D E E K N E S G L T E Y R L V S I N K S S P L Q K Q L P A F I S E D A S G Y L T S S W L T. This fragment is expressed in Wheat germ and is suitable for various applications including SDS-PAGE, ELISA, and Western Blotting .

What alternative nomenclature exists for PAR1 in the scientific literature?

In scientific literature, PAR1 may be referred to by several alternative names including: CF2R, TR, F2R, Proteinase-activated receptor 1, PAR-1, Coagulation factor II receptor, and Thrombin receptor. This diverse nomenclature reflects the multifunctional nature of the receptor and its discovery by different research groups focused on various aspects of its function .

How should researchers formulate robust questions when designing PAR1/F2R studies?

When designing studies involving PAR1/F2R, researchers should employ structured frameworks such as PICO (Patient/population; Intervention; Comparison; Outcome) to ensure their research questions address all relevant components. Additionally, researchers should evaluate their questions using the FINER criteria (Feasible; Interesting; Novel; Ethical; and Relevant) to ensure practical feasibility and scientific value. Before proceeding with experimentation, conduct a thorough literature review to identify existing knowledge gaps and ensure the novelty of your research question .

What expression systems are optimal for producing functional Recombinant Human PAR1?

For functional studies of Recombinant Human PAR1, wheat germ expression systems have demonstrated effectiveness for producing the 42-102 amino acid fragment with proper folding and functionality. When selecting an expression system, consider the specific experimental requirements, as different systems may produce proteins with varying post-translational modifications. For structural studies or activity assays, it may be necessary to evaluate multiple expression systems to identify the one that produces protein with optimal characteristics for your specific application .

What analytical techniques are most suitable for characterizing PAR1-ligand interactions?

For characterizing PAR1-ligand interactions, researchers should consider multiple complementary techniques. Surface Plasmon Resonance (SPR) provides real-time binding kinetics data, while isothermal titration calorimetry (ITC) offers thermodynamic parameters. Functional assays measuring calcium flux in cell-based systems can verify activity. Additionally, co-immunoprecipitation experiments can identify binding partners in complex biological systems. The choice of technique should be guided by the specific research question, with consideration given to sensitivity requirements and the nature of the interaction being studied .

How does PAR1 signaling differ when activated by thrombin versus activated protein C (APC)?

PAR1 exhibits biased agonism, producing dramatically different cellular responses depending on the activating protease. When activated by the coagulant protease thrombin, PAR1 signaling leads to Ras homolog gene family member A (RhoA) activation, resulting in disassembly of adherens junctions and disruption of the endothelial barrier. In contrast, when activated by the anticoagulant protease activated protein C (APC), PAR1 signaling promotes activation of Ras-related C3 botulinum toxin substrate 1 (Rac1), which enhances endothelial barrier protection. This signaling dichotomy demonstrates how a single receptor can mediate opposing biological effects through different downstream pathways .

What role do β-arrestins play in PAR1-mediated cytoprotective signaling?

β-arrestins serve as critical scaffold proteins in PAR1-mediated cytoprotective signaling, particularly when activated by APC. In human endothelial cells, PAR1 and β-arrestins form a preassembled complex and cosegregate in caveolin-1–enriched fractions. APC-activated PAR1 cytoprotective signaling is specifically mediated by β-arrestin recruitment and activation of the dishevelled-2 (Dvl-2) scaffold, rather than through G protein α inhibiting activity polypeptide 2 (Gαi) signaling. Depletion of β-arrestin expression by RNA interference results in the loss of APC-induced Rac1 activation without affecting thrombin-stimulated RhoA signaling, demonstrating the selective importance of β-arrestins in cytoprotective but not pro-inflammatory PAR1 signaling .

How is PAR1 compartmentalization related to its signaling specificity?

PAR1 compartmentalization in caveolar microdomains is essential for its ability to transduce specific signals. Studies have demonstrated that APC cytoprotective signaling requires this compartmentalization, whereas thrombin-induced inflammatory signaling does not show the same dependency. The spatial organization of PAR1 in these specialized membrane domains facilitates its interaction with specific signaling partners like β-arrestins and Dvl-2, which are critical for cytoprotective signaling. This compartmentalization provides a mechanism by which a single receptor can discriminate between different ligands and initiate distinct signaling cascades leading to opposing cellular outcomes .

How can researchers distinguish between G protein-dependent and β-arrestin-dependent signaling in PAR1 studies?

To distinguish between G protein-dependent and β-arrestin-dependent signaling in PAR1 studies, researchers should employ multiple complementary approaches. RNA interference targeting specific G protein subunits or β-arrestins can assess pathway dependence. Pharmacological tools such as pertussis toxin can inhibit specific G protein signaling without affecting β-arrestin pathways. BRET/FRET-based biosensors can monitor protein-protein interactions in real-time. Additionally, measuring downstream effectors specific to each pathway (e.g., RhoA for G protein signaling, Rac1 for β-arrestin signaling in the case of PAR1) provides functional readouts. Combining these approaches enables comprehensive characterization of signaling bias .

What factors might contribute to contradictory results in PAR1 signaling studies?

Contradictory results in PAR1 signaling studies may arise from several factors. Cell type-specific expression of signaling components can dramatically alter outcomes, as endothelial cells express different scaffolding proteins than platelets or epithelial cells. The concentration of activating proteases (thrombin or APC) can shift signaling bias. Receptor compartmentalization in membrane microdomains varies between cell types and culture conditions. Importantly, the timing of measurements is critical, as G protein signaling typically occurs rapidly (seconds to minutes) while β-arrestin-mediated responses may develop more slowly (minutes to hours). Finally, the presence of co-receptors like endothelial protein C receptor (EPCR) can modify PAR1 signaling specificity .

How can understanding PAR1 biased signaling inform therapeutic development?

Understanding PAR1 biased signaling provides an opportunity for developing pathway-selective therapeutics with improved safety profiles. By designing compounds that selectively activate cytoprotective β-arrestin-dependent pathways while avoiding pro-inflammatory G protein pathways, researchers may develop therapeutics that preserve the beneficial effects of PAR1 signaling while minimizing adverse effects. This concept has been validated in studies showing that APC's barrier-protective effects operate through β-arrestin and Dvl-2 scaffolds, suggesting that compounds mimicking this interaction could be developed for treating vascular inflammation and sepsis. Structure-activity relationship studies focusing on biased ligands may yield more selective PAR1-targeted therapeutics .

What methodological approaches are most effective for studying PAR1 in inflammatory disease models?

For studying PAR1 in inflammatory disease models, a multi-faceted approach is most effective. In vitro models using human endothelial cells with genetic manipulation (siRNA, CRISPR/Cas9) of PAR1 or its signaling partners can establish mechanistic principles. Transwell permeability assays provide functional readouts of endothelial barrier function. In vivo, conditional knockout models with tissue-specific deletion of PAR1 avoid developmental effects while enabling tissue-specific interrogation. Biased PAR1 agonists/antagonists can distinguish pathway-specific effects in disease models. For translational relevance, ex vivo studies using patient-derived samples help validate findings in human disease contexts. Integration of these approaches provides robust evidence for PAR1's role in inflammatory diseases .

Table 1: Comparative PAR1 Signaling Pathways Activated by Different Proteases

FeatureThrombin-PAR1 PathwayAPC-PAR1 Pathway
Primary GTPase activatedRhoARac1
Scaffold proteinsG proteinsβ-arrestins, Dvl-2
Effect on endothelial barrierDisruptionProtection
Dependence on caveolar domainsLowHigh
Inflammatory outcomePro-inflammatoryAnti-inflammatory
β-arrestin requirementNoYes
Typical measurement timeframeRapid (seconds-minutes)Delayed (minutes-hours)

Table 2: FINER Criteria for Evaluating PAR1 Research Questions

ComponentDefinitionSelf-assessment questions for PAR1 researchers
FeasibleCan the research question be answered given available resources?Do you have access to recombinant PAR1 proteins or expression systems? Do you have expertise in G protein and β-arrestin signaling assays?
InterestingIs the research question exciting to you and the scientific community?Does your project address unresolved questions about PAR1 signaling bias? Is there interest in PAR1's role in your disease model of interest?
NovelDoes the research question fill an existing knowledge gap?Has the specific aspect of PAR1 signaling you're studying been previously characterized? What unique perspective does your approach offer?
EthicalDoes the research question protect/respect subjects of interest?If using animal models, have you minimized numbers while maintaining statistical power? Have human sample studies received appropriate ethical approvals?
RelevantWill the research question lead to societal improvements?Could your findings inform development of new therapeutics targeting PAR1? Does your work have implications for understanding vascular diseases?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.