Recombinant Human Proteinase-activated receptor 4 (F2RL3)

Shipped with Ice Packs
In Stock

Description

Genetic Variants and Functional Impact

A key genetic variant in F2RL3 (rs773902) encodes an alanine (Ala120) or threonine (Thr120) residue at position 120 in the second transmembrane domain. This polymorphism influences receptor signaling and thrombotic risk .

VariantPopulation PrevalenceG Protein SignalingThrombus FormationAntiplatelet Response
Ala12081% (European ancestry)Normal Gαq and Gα13 activationReducedEffective (aspirin/clopidogrel)
Thr12057% (African ancestry)Enhanced Gαq/Gα13 activation Increased Reduced efficacy

Mechanistic Insights:

  • Thr120 enhances Gαq-mediated calcium mobilization and Gα13-driven RhoA activation, amplifying platelet aggregation and cytoskeletal reorganization .

  • Ex vivo studies show Thr120 carriers exhibit 2–3× higher thrombus formation under high shear stress compared to Ala120 homozygotes .

Recombinant Protein Applications

Recombinant F2RL3 is used in research to study receptor function, signaling pathways, and therapeutic interactions.

ApplicationMethod/Detail
Control FragmentA 214–242 amino acid fragment (Thermofisher) blocks antibody binding in IHC/WB .
Membrane ReconstitutionExpressed in High Five insect cells (Baculovirus system) to study G protein coupling .
Platelet StudiesRecombinant PAR4-Thr120 variants show biased signaling in platelet spreading assays .

Production Systems:

  • E. coli and insect cell systems are used for recombinant F2RL3 production, yielding functional receptors for structural and functional studies .

Therapeutic Implications

The Thr120 variant has significant clinical implications:

  1. Cardiovascular Risk: Higher thrombus formation in Thr120 carriers increases susceptibility to myocardial infarction and stroke .

  2. Antiplatelet Resistance: Reduced efficacy of aspirin and clopidogrel in Thr120 subjects suggests a need for alternative therapies (e.g., PAR4 antagonists like YD-3 or ML-354) .

Signaling Pathways and Downstream Effects

F2RL3 signals through two primary pathways:

PathwayEffectorCellular Response
GαqPLC-β → IP3/DAGCalcium mobilization, platelet granule release
Gα13RhoA → CytoskeletonPlatelet shape change, adhesion, aggregation

Protease Cleavage Sites:

ProteaseCleavage SiteReceptor Activation
ThrombinK38↓T39 (human)Full activation
TrypsinUnknownPartial activation

Research Gaps and Future Directions

  1. Population-Specific Therapies: Clinical trials are needed to assess PAR4 antagonist efficacy in Thr120 carriers .

  2. Structural Insights: Cryo-EM studies of F2RL3 bound to G proteins could elucidate signaling bias mechanisms.

  3. Epigenetic Regulation: Methylation of F2RL3 has been linked to disease states, warranting further investigation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
F2RL3; PAR4; Proteinase-activated receptor 4; PAR-4; Coagulation factor II receptor-like 3; Thrombin receptor-like 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
48-385
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
GYPGQVCANDSDTLELPDSSRALLLGWVPTRLVPALYGLVLVVGLPANGLALWVLATQAP RLPSTMLLMNLAAADLLLALALPPRIAYHLRGQRWPFGEAACRLATAALYGHMYGSVLLL AAVSLDRYLALVHPLRARALRGRRLALGLCMAAWLMAAALALPLTLQRQTFRLARSDRVL CHDALPLDAQASHWQPAFTCLALLGCFLPLLAMLLCYGATLHTLAASGRRYGHALRLTAV VLASAVAFFVPSNLLLLLHYSDPSPSAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSAEF RDKVRAGLFQRSPGDTVASKASAEGGSRGMGTHSSLLQ
Uniprot No.

Target Background

Function
Protease-activated receptor 4 (PAR4) is a G protein-coupled receptor activated by thrombin or trypsin. It stimulates phosphoinositide hydrolysis and is implicated in platelet activation.
Gene References Into Functions
  1. PAR4 rs773902 polymorphism influences platelet reactivity by modulating Ca(2+) mobilization and ERK activation. PMID: 29289806
  2. Thrombin binding to PAR4's extracellular loop II (ECLII) is crucial for its cleavage and activation. PMID: 28448853
  3. PAR4 mediates platelet aggregation, and its inhibition exhibits antithrombotic effects. PMID: 28053157
  4. PAR4 is essential for platelet procoagulant function during thrombus formation. PMID: 26878340
  5. AHRR and F2RL3 methylation levels inversely correlate with smoking status and predict lung cancer risk. PMID: 28453567
  6. F2RL3 variants significantly alter platelet PAR4 reactivity, particularly when using PAR1 antagonists. PMID: 26966273
  7. Internalization of activated PAR4 is linked to proper ERK1/2 and Akt activation. PMID: 27402844
  8. An intracellular PAR4 C-terminal motif regulates calcium signaling and beta-arrestin interactions. PMID: 28126849
  9. PAR1 and PAR4 contribute to thrombin-mediated activation of the platelet fibrin receptor (GPIIbIIIa). PMID: 27784794
  10. PAR4 suppression inhibits SW620 cell migration but not proliferation. PMID: 27126938
  11. GPIbalpha and PAR4 are both required for thrombin-induced reactive oxygen species formation in platelets. PMID: 26569550
  12. Bladder PAR activation triggers urothelial MIF release and signaling via CXCR4, leading to abdominal hypersensitivity. PMID: 26020638
  13. PAR4 and Trefoil factor 2 are expressed in human colorectal cancer. PMID: 25876034
  14. PAR4 signaling pathways are involved in pain development and maintenance. PMID: 25664811
  15. This review summarizes PAR4's roles in coagulation and other protease pathways. PMID: 25120239
  16. F2RL3 methylation strongly predicts lung cancer risk and mortality, especially in older individuals. PMID: 25821117
  17. Lower F2RL3 methylation predicts increased mortality risk, potentially linked to smoking-related adverse effects. PMID: 24510982
  18. Exosite II is essential for PAR4 activation. PMID: 24990072
  19. Evidence refutes the hypothesis that PAR-1 and PAR-4 stimulation differentially triggers alpha-granule release from platelets. PMID: 24776597
  20. Black volunteers exhibit hyperaggregable platelets in response to PAR4 stimulation compared to white volunteers. PMID: 25278289
  21. PAR-4 plays a significant role in diabetic vasculopathy. PMID: 25239438
  22. Three common single nucleotide polymorphisms (SNPs) in PAR4 (F2RL3) are associated with PAR4-induced platelet aggregation. PMID: 25293779
  23. PAR4-P2Y12 interaction supports arrestin-mediated sustained signaling to Akt. PMID: 24723492
  24. PAR4 and GPVI-mediated platelet reactivity involves 12-lipoxygenase. PMID: 23784669
  25. Phosphatidylcholine transfer protein contributes to racial differences in PAR4-mediated platelet activation. PMID: 24216752
  26. The F2RL3 rs773857 risk allele is associated with increased platelet count and hyperactivity. PMID: 22228373
  27. PAR4 stimulation leads to faster and more robust thrombin generation compared to PAR-1 stimulation. PMID: 23307185
  28. F2RL3 methylation may mediate the detrimental impact of smoking on coronary heart disease mortality. PMID: 22511653
  29. PAR4 is down-regulated in colonic mast cells in post-infectious irritable bowel syndrome. PMID: 22151913
  30. PAR2 plays a novel role in PAR4 membrane trafficking. PMID: 22411985
  31. Mutations disrupting PAR4 dimer formation reduce calcium mobilization in response to PAR4 agonist peptides. PMID: 22318735
  32. PKC inhibition enhances Ca2+ signaling and phosphatidylserine exposure downstream of PAR-1 but not PAR-4 in platelets. PMID: 21649850
  33. PAR4 down-regulation is frequent in aggressive gastric cancers. PMID: 21635966
  34. PAR4 signaling counteracts PAR1 signaling down-regulation in human platelets. PMID: 21391917
  35. High glucose enhances smooth muscle cell responsiveness to thrombin via PAR-4 upregulation mediated by PKC and NFkappaB. PMID: 21164077
  36. Platelet protease-activated receptor signaling differentially activates cytosolic phospholipase A2alpha for cyclooxygenase-1 and 12-lipoxygenase. PMID: 21127289
  37. Lower levels of PAR-1 and PAR-4 contribute to poor thrombin-induced aggregation in newborn platelets. PMID: 20807173
  38. Low alpha-thrombin concentrations accelerate tissue factor-induced thrombin generation via PAR-3 and PAR-4 in vascular smooth muscle cells. PMID: 20930172
  39. Human cytomegalovirus increases thrombin sensitivity in endothelial cells by upregulating PARs expression. PMID: 20155436
  40. SPSB1 and SPSB4 strongly bind to Par-4 and VASA peptides. PMID: 20561531
  41. PAR1 and PAR4-activating peptides induce annexin V binding in diluted whole blood and platelet-rich plasma. PMID: 20230207
  42. Thrombin enhances chondrosarcoma cell migration via PAR/PLC/PKCalpha/c-Src/NF-kappaB signaling. PMID: 20175118
  43. Complement protease MASP-1 activates endothelial cells by cleaving PAR4. PMID: 19667088
  44. PAR4 induces IL-6, IL-8, and PGE2 release in respiratory epithelial cells. PMID: 11907122
  45. PAR4 agonist AYPGKF treatment results in thrombin-induced thromboxane production in platelets. PMID: 12006403
  46. PAR4 signaling stabilizes platelet aggregates in the absence of P2Y12 activation. PMID: 12008957
  47. PAR4 activation is independent of GPIbalpha and ADP. PMID: 12871418
  48. PAR4 plays a crucial role in regulating thromboxane formation in platelets. PMID: 12888878
  49. PAR4 exodomains utilize dual prolines and an anionic retention motif for thrombin recognition and cleavage. PMID: 13678420
  50. PAR-1 and PAR-4 are involved in GPIb translocation into the platelet cytoskeleton. PMID: 14521606
Database Links

HGNC: 3540

OMIM: 602779

KEGG: hsa:9002

STRING: 9606.ENSP00000248076

UniGene: Hs.137574

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed, with highest levels in lung, pancreas, thyroid, testis and small intestine. Not expressed in brain, kidney, spinal cord and peripheral blood leukocytes. Also detected in platelets.

Q&A

What is the molecular structure and basic function of human PAR4 (F2RL3)?

PAR4 (F2RL3) is a member of the large family of 7-transmembrane-region receptors that couple to guanosine-nucleotide-binding proteins. It belongs specifically to the protease-activated receptor family and functions as a key mediator in platelet activation pathways. The receptor is activated through proteolytic cleavage of its extracellular amino terminus, creating a new amino terminus that functions as a tethered ligand to activate the receptor itself .

PAR4 is primarily activated by thrombin and trypsin, serving as a critical regulator of platelet reactivity. The receptor's structure includes an extracellular N-terminus, seven transmembrane domains, and an intracellular C-terminus that couples to G proteins for downstream signaling .

What are the primary signaling pathways associated with PAR4 activation?

PAR4 activation triggers multiple downstream signaling cascades, primarily through coupling with G proteins. The two main G protein pathways associated with PAR4 are:

  • Gαq Pathway: This pathway leads to phospholipase C activation, calcium mobilization, and protein kinase C activation, ultimately resulting in platelet aggregation.

  • Gα13 Pathway: This pathway activates RhoA and leads to cytoskeletal reorganization and platelet shape change.

Research has demonstrated that PAR4 activation leads to both G protein pathways, with differences in activation kinetics observed between genetic variants. For example, PAR4-Thr120 variant shows enhanced activation of both Gαq and Gα13 pathways compared to PAR4-Ala120 .

How do PAR4-specific agonists differ from natural activators like thrombin?

PAR4 can be activated by either natural proteases (thrombin, trypsin) or synthetic peptides that mimic the tethered ligand. The most commonly used synthetic agonist is PAR4-activating peptide (PAR4-AP; AYPGKF), which directly binds to and activates the receptor without requiring proteolytic cleavage.

While thrombin cleaves the receptor to expose the tethered ligand, PAR4-AP bypasses this cleavage step. This distinction is methodologically important as synthetic peptides allow for specific targeting of PAR4 without activating other thrombin receptors. Research has shown potential differences in signaling bias between activation by thrombin versus synthetic peptides, similar to observations with PAR1 .

What is known about the rs773902 polymorphism and its impact on PAR4 function?

The rs773902 single nucleotide polymorphism (SNP) in the F2RL3 gene results in an alanine/threonine polymorphism at amino acid 120 in the second transmembrane domain of PAR4. This variant has significant functional consequences:

VariantAllele Frequency in African AncestryAllele Frequency in European AncestryFunctional Impact
PAR4-Thr12057.2%19.0%Enhanced signaling, increased platelet reactivity
PAR4-Ala12042.8%81.0%Lower signaling activity, standard platelet reactivity

The PAR4-Thr120 variant demonstrates significantly enhanced G protein activation kinetics for both Gαq and Gα13 pathways compared to PAR4-Ala120. This translates to increased platelet reactivity and enhanced thrombus formation in individuals carrying at least one copy of the PAR4-Thr120 allele .

How does the Y157C variant affect PAR4 function and potential clinical outcomes?

The Y157C variant (tyrosine 157 to cysteine substitution) in PAR4 represents a rare but high-impact genetic variant. Research has shown that:

  • Platelets from individuals heterozygous for Y157C exhibit reduced PAR4 activation responses

  • The variant causes altered anterograde trafficking of the receptor to the surface membrane, resulting in decreased surface expression

  • Y157C carriers show greater levels of inhibition with therapeutic PAR1 antagonists like vorapaxar compared to individuals with wild-type PAR4

  • This variant potentially represents a risk factor for bleeding, particularly during antithrombotic therapies targeting the PAR pathway

This variant demonstrates that rare genetic variants in F2RL3 can have significant impacts on platelet function and potentially on clinical outcomes related to thrombosis and hemostasis.

What are the recommended methods for measuring PAR4 activation in platelets?

Several complementary methodologies can be employed to assess PAR4 activation:

  • Platelet Aggregation: Using a lumi-aggregometer to measure light transmittance in platelets stimulated with thrombin or PAR4-AP (AYPGKF). This approach allows real-time monitoring of aggregation over 6 minutes at 37°C under stirring conditions (1100 rpm) .

  • Shape Change Analysis: Treating platelets with EGTA (2 mmol/L) before agonist stimulation in a lumi-aggregometer to quantify the platelet shape change response, which reflects early activation events .

  • Platelet Spreading Assays: Coating glass coverslips with fibrinogen (50 μg/mL), allowing platelets treated with indomethacin and apyrase to spread after PAR4-AP stimulation, then recording and analyzing spreading using fluorescent microscopy .

  • RhoA Activation Assays: Measuring the levels of active RhoA (normalized to total RhoA) as a downstream marker of Gα13 pathway activation following PAR4 stimulation .

How can recombinant PAR4 proteins be produced for research applications?

Recombinant PAR4 proteins can be generated using baculovirus expression systems:

  • Generate recombinant human PAR4 baculoviruses from pFastBac-1 donor plasmids using the Bac-to-Bac system

  • Infect mid-log growth phase High Five cells with dilutions of secondary-amplified baculoviruses expressing the desired PAR4 variant (e.g., PAR4-Ala120 or PAR4-Thr120)

  • After 48 hours of infection, lyse cells in native buffer (typically containing HEPES, MgCl₂, EDTA, and DTT)

  • Purify the recombinant protein using appropriate chromatography techniques

For control fragments, commercially available recombinant proteins like Human PAR4 (aa 214-242) can be used for blocking experiments in immunohistochemistry and Western blotting. These fragments are particularly useful for antibody validation and specificity testing .

What assays are available for measuring G protein signaling downstream of PAR4?

Several complementary assays can be used to assess G protein signaling downstream of PAR4:

  • Reconstitution Assays: Membranes expressing human PAR4 variants can be reconstituted with either Gq or G13 to determine the kinetics of G protein activation following receptor stimulation .

  • RhoA Activation Assays: For Gα13 pathway assessment, measuring active RhoA levels using pull-down assays followed by immunoblotting. Results are typically normalized to total RhoA and reported as fold change compared to resting samples .

  • Calcium Mobilization: For Gαq pathway assessment, fluorescence-based calcium flux assays can measure intracellular calcium mobilization following PAR4 activation.

  • Platelet Function Assays: Ex vivo thrombus formation in microfluidic chambers can be used to assess the functional consequences of PAR4 variant-mediated signaling differences .

How do PAR4 genetic variants impact response to antiplatelet therapy?

PAR4 genetic variants, particularly the rs773902 polymorphism, significantly affect response to standard antiplatelet therapies:

  • Aspirin Resistance: Individuals expressing at least one copy of the PAR4-Thr120 variant show high on-treatment platelet reactivity in response to PAR4 stimulation despite aspirin therapy (81 mg daily for 7 days) .

  • Clopidogrel (Plavix) Resistance: Similar high on-treatment platelet reactivity is observed in PAR4-Thr120 carriers taking clopidogrel (75 mg daily for 7 days) .

  • Enhanced Thrombus Formation: Ex vivo thrombus formation in microfluidic chambers is enhanced in whole blood from subjects expressing PAR4-Thr120 relative to PAR4-Ala120 homozygotes, even in the presence of antiplatelet therapy .

These findings suggest that standard-of-care antiplatelet therapies may provide reduced protection in individuals carrying the PAR4-Thr120 variant, which is estimated to include >81% of Black individuals and 34% of White individuals based on self-identified race and ethnicity .

What is the potential of PAR4 methylation as a biomarker for coronary heart disease?

Recent research has identified F2RL3 methylation as a potential biomarker for coronary heart disease (CHD):

  • Blood-based F2RL3 methylation patterns, particularly at specific CpG sites including cg03636183 and cg24704287, have been associated with CHD risk in Chinese populations .

  • The relationship appears to be especially significant in:

    • Older individuals

    • People with myocardial infarction (MI)

  • Methodological approaches for assessing F2RL3 methylation include:

    • Bisulfite conversion of DNA

    • PCR amplification with bisulfite-specific primers

    • Analysis using Agena EpiTyper Assay with mass spectrometry-based detection

The combination of F2RL3 methylation assessment with conventional risk factors may provide an approach to evaluate CHD at early stages, potentially addressing the limitations of currently available biomarkers like hsCRP, interleukin-6, and MPO .

What are the main challenges in studying PAR4 across different racial and ethnic populations?

Studying PAR4 across diverse populations presents several challenges:

  • Allele Frequency Differences: The PAR4-Thr120 variant is substantially more common in individuals of African ancestry (57.2% of alleles) compared to European ancestry (19.0%), requiring balanced study designs to capture population-specific effects .

  • Contribution to Racial Differences: The rs773902 polymorphism accounts for approximately 50% of the racial difference in platelet activation by PAR4, suggesting additional genetic or environmental factors contribute to observed differences .

  • Clinical Trial Design: Most clinical trials for antiplatelet therapies have underrepresented minority populations, potentially missing important pharmacogenetic interactions with PAR4 variants.

  • Complex Risk Assessment: Researchers must integrate PAR4 variant data with other cardiovascular risk factors that may also vary by race/ethnicity to develop comprehensive risk prediction models.

How should experimental designs account for PAR4 genetic variants?

When designing experiments involving PAR4, researchers should consider:

  • Genotyping: All subjects should be genotyped for the rs773902 SNP in the PAR4 gene (F2RL3) by methods such as Taqman allelic discrimination real-time PCR .

  • Stratified Analysis: Results should be stratified by PAR4 genotype to identify potential variant-specific effects.

  • Dose-Response Considerations: PAR4-Thr120 carriers may require different concentrations of agonists and inhibitors due to altered receptor sensitivity.

  • Translational Relevance: In vitro and ex vivo findings should be discussed in the context of potential clinical implications, particularly regarding antiplatelet therapy efficacy.

  • Controls for Population Structure: When comparing racial/ethnic groups, appropriate statistical controls for population structure should be implemented to avoid confounding.

What are the emerging therapeutic implications of PAR4 research?

Recent PAR4 research suggests several emerging therapeutic directions:

  • PAR4-Targeted Therapies: The differential response to current antiplatelet therapies based on PAR4 variants suggests that direct PAR4 antagonists might be valuable, particularly for populations with high PAR4-Thr120 allele frequencies.

  • Personalized Antiplatelet Approaches: Genotyping for PAR4 variants could inform individualized selection and dosing of antiplatelet agents.

  • Dual Pathway Inhibition: Given the enhanced RhoA-dependent platelet shape change in PAR4-Thr120 carriers, targeting both Gαq and Gα13 pathways might provide more complete inhibition.

  • Biomarker Development: F2RL3 methylation patterns could be developed into early diagnostic markers for coronary heart disease risk assessment .

  • Consideration of Rare Variants: The characterization of the Y157C variant indicates that rare variants in PAR4 may have significant clinical implications for bleeding risk during antithrombotic therapy .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.