Recombinant Human Pulmonary surfactant-associated protein B (SFTPB)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Biological Function

SFTPB is an amphipathic protein (40.4–51.1 kDa) composed of 363 amino acids (201–381aa) in recombinant forms, with N-terminal His/GST tags or MBP fusions depending on the expression system . Its primary functions include:

  • Surface tension reduction: Lowers alveolar surface tension from ~70 mN/m to ~2 mN/m, preventing lung collapse .

  • Surfactant monolayer stabilization: Enhances phospholipid spreading and collapse resistance .

  • Lamellar body formation: Critical for processing surfactant protein-C (SP-C) and lipid packaging in type II pneumocytes .

Key Production Challenges

  • Glycosylation: Human-relevant post-translational modifications require eukaryotic systems (e.g., yeast, insect cells) .

  • Solubility: Amphipathic nature necessitates specialized buffers (e.g., Tris/PBS with trehalose) .

Respiratory Disease Models

DiseaseKey FindingsSource
COPDSFTPB levels ↓ in acute exacerbations; inversely correlates with IL-6, PTGS2 ↑
Neonatal RDSMutations (e.g., 120ins2) cause SP-B deficiency, fatal respiratory failure
ARDSDimeric SP-B(1-25) improves surfactant function in experimental models

Cardiovascular Disease Links

  • HDL Association: SFTPB binds to HDL; elevated levels predict incident CVD in type 1 diabetes (HR=1.33 per 1 SD increase) .

  • Anti-inflammatory Activity: SFTPB-enriched HDL reduces TNF-α-induced VCAM-1/ICAM-1 expression in endothelial cells .

Clinical and Diagnostic Potential

ApplicationEvidenceSource
Surfactant Replacement TherapyRecombinant SFTPB enhances synthetic surfactants (e.g., Curosurf®)
Biomarker for COPDSerum SFTPB ↓ correlates with disease progression (P=0.009)
CVD Risk StratificationPlasma SFTPB levels predict incident CVD independent of smoking

Challenges and Future Directions

  • Therapeutic Limitations: Current recombinant forms lack native lipid interactions; full-length SP-B is required for optimal function .

  • Genetic Variants: Polymorphisms (e.g., 1580C/T) alter glycosylation and disease susceptibility .

  • Delivery Systems: Nanoparticle formulations under investigation to improve surfactant delivery .

Product Specs

Buffer
Lyophilized from Tris/PBS-based buffer containing 6% Trehalose.
Form
Available as either liquid or lyophilized powder.
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order, and we will prepare the product accordingly.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the liquid form has a shelf life of 6 months when stored at -20°C/-80°C. The lyophilized form typically exhibits a longer shelf life of 12 months when stored under the same temperature conditions (-20°C/-80°C).
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 6xHis-SUMO-tagged
Synonyms
SFTPB; SFTP3; Pulmonary surfactant-associated protein B; SP-B; 18 kDa pulmonary-surfactant protein; 6 kDa protein; Pulmonary surfactant-associated proteolipid SPL(Phe
Datasheet & Coa
Please contact us to get it.
Expression Region
201-279aa
Mol. Weight
24.7kDa
Protein Length
Full Length of Mature Protein
Purity
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.
Source
in vitro E.coli expression system
Species
Homo sapiens(Human)
Target Names
SFTPB
Target Protein Sequence
FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Pulmonary surfactant-associated proteins play a crucial role in maintaining alveolar stability by reducing surface tension at the air-liquid interface within the peripheral air spaces. SP-B significantly enhances the collapse pressure of palmitic acid, reaching nearly 70 millinewtons per meter.
Gene References Into Functions
  1. The rs7316 polymorphism has been linked to respiratory distress syndrome in premature Iranian newborns. PMID: 28738720
  2. TGF beta has been shown to significantly decrease the expression of SP-A, SP-B, SP-C, fatty acid synthase, and the phospholipid transporter ABCA3. Conversely, TGF beta increased protein levels of SP-D while exhibiting minimal changes in mRNA levels. PMID: 29621540
  3. Surfactant protein B has been demonstrated to suppress lung cancer progression by inhibiting secretory phospholipase A2 activity and the production of arachidonic acid. PMID: 28743125
  4. Research indicates that the thermal transitions observed in the N-terminal propeptide of proSP-B (SP-BN) may correspond to the unfolding of specific protein domains or subdomains, and/or to oligomers dissociation. Notably, the overall protein demonstrates resistance to temperature-induced unfolding up to approximately 86 degrees C. PMID: 27380171
  5. SP-A (+186A/G) and SP-B (1580C/T) polymorphisms are strongly associated with the risk of respiratory distress syndrome (RDS) in preterm infants. Furthermore, reduced serum SP-A levels have been correlated with a heightened risk of RDS, suggesting their potential as novel biomarkers for RDS detection and monitoring. PMID: 28011976
  6. Variability has been observed regarding SPA and pro-SPB expression in the majority of subjects. Some lungs exhibit a higher expression of SPA, while others demonstrate greater immunoreactivity of pro-SPB. The expression of both surfactant proteins does not strictly correlate with gestational age. PMID: 27734990
  7. Studies in Han populations have revealed no significant association between the gene polymorphism of the R236C site in exon 7 of the SP-B gene and the incidence of neonatal respiratory distress syndrome (NRDS). PMID: 27655533
  8. Rare mutations in surfactant-associated genes contribute to neonatal respiratory distress syndrome. While the frequency of these gene mutations in the Chinese population remains unknown, comprehensive resequencing of all exons of the surfactant protein-B (SFTPB) gene did not identify any rare mutations in SFTPB. PMID: 26547207
  9. Research suggests that mice carrying the SP-B-C allele are more susceptible to S. aureus pneumonia compared to mice with the SP-B-T allele. Furthermore, CMC2.24 has been found to attenuate lung injury, thereby reducing mortality. PMID: 26863117
  10. In term newborns experiencing pneumonia, SP-B levels increase relative to total phospholipids and disaturated-phosphatidylcholine, and turnover occurs at an accelerated rate. PMID: 26107393
  11. SP-B -18C/A and 1580C/T polymorphisms have been associated with bronchopulmonary dysplasia. PMID: 26045806
  12. Studies have conclusively demonstrated that the human SP-B C allele exhibits increased susceptibility to bacterial pneumonia compared to the SP-B T allele in vivo. PMID: 26620227
  13. No significant differences in the frequency of occurrence of unfavorable genotypes CC rs1965708, AA rs1059046 of the SFTPA2 gene and CC rs1130866 of the SFTPB gene were detected in influenza patients compared to individuals in the control group. PMID: 26950992
  14. Researchers investigated the relationship between SP-A2 and SP-B gene polymorphisms and respiratory distress syndrome in preterm neonates. PMID: 26061924
  15. Given the observed findings, SP-B deficiency presents a promising area for further research in regenerative therapy, particularly concerning stem cell administration in models of postnatal SP-B deficiency. PMID: 25565191
  16. Data strongly support a critical role of SP-B in promoting pulmonary surface film formation. PMID: 25360829
  17. SFTPB variants have been linked to susceptibility to chronic obstructive pulmonary disease (COPD) and lung function in the Chinese Han population. PMID: 25299874
  18. Surfactant protein B gene polymorphism has been associated with severe influenza. PMID: 24337193
  19. Data supports the hypothesis that proSP-B glycosylation due to Ile131Thr variation may play a causal role in genetic susceptibility to acute respiratory distress. PMID: 24002332
  20. Findings suggest that polymorphisms in SP-B intron 4 and C/A-18 might be associated with BPD in Chinese Han infants, with the del allele of intron 4 and A allele of C/A-18 potentially serving as markers of disease susceptibility. PMID: 23771654
  21. No evidence has been found to support an association between common polymorphisms in the SP-B and SP-D genes and COPD risk (all p>0.05). PMID: 24093802
  22. Glucocorticoids have been shown to mediate surfactant protein B production, maturation, and release, and these effects are amplified by caffeine. PMID: 24163141
  23. Macrophages play a role in repressing SFTPB expression by LPS, and macrophage-released cytokines (including TNF) regulate the transcription factor CEBPB. PMID: 23590297
  24. The D2S388-5 microsatellite polymorphism of surfactant protein B may be associated with susceptibility to COPD in Xinjiang Kazakhs. PMID: 23088317
  25. Elevated expression has been observed in nasal mucosa in patients with chronic rhinosinusitis with polyps. PMID: 23406594
  26. Mutations in exon 4 of the surfactant protein B gene demonstrate an association between homozygous mutations with the C/C genotype in the SP-B gene and neonatal respiratory distress. PMID: 23330012
  27. Caffeine has been shown to induce the expression of SP-transcription factors and influences the signaling pathways of glucocorticoids, amplifying their effects. PMID: 23272120
  28. Research indicates that tryptophan oxidation causes significant disruptions in helical structure and lipid interactions. PMID: 21128671
  29. A comprehensive review focuses on published association studies involving surfactant proteins A and D genetic polymorphisms with respiratory, and non-respiratory diseases in adults, children, and newborns. [review] PMID: 22201752
  30. A study demonstrated that the AG genotype of the AG 9306 polymorphism acted as a protective factor against the development of respiratory distress syndrome. Other polymorphisms examined (G/C at 8714, C/T at 1580, A/C at -18) were not associated with RDS. PMID: 21180884
  31. In patients undergoing major vascular abdominal surgery, SP-B values exhibit a progressive increase during mechanical ventilation stages compared to advanced glycation end-products (RAGE) kinetics. PMID: 21736957
  32. The SP-B 1580C/T polymorphism contributes to the etiology of respiratory distress syndrome. PMID: 22289747
  33. Circulating levels of SP-B increase with greater smoking burden and independently associate with abdominal aortic plaque among current smokers. PMID: 21817103
  34. Genetic variations in the gene encoding surfactant protein B have been linked to more severe lung injury, as evidenced by the association of specific single nucleotide polymorphism genotypes and haplotypes. PMID: 21283003
  35. Surfactant protein B and RAGE levels increase in the plasma during cardiopulmonary bypass. PMID: 20650982
  36. Surfactant protein B polymorphisms play a role in pulmonary function and COPD. PMID: 20693256
  37. Disaturated-phosphatidylcholine and surfactant protein-B exhibit distinct turnover patterns in both healthy and diseased lungs. PMID: 21429235
  38. The absence of this protein resulted in Congenital pulmonary alveolar proteinosis in two newborn children. PMID: 20005435
  39. Surfactant protein-B 121ins2 heterozygosity has been associated with reduced lung function and an increased risk for COPD among smokers. PMID: 19833825
  40. A review focuses on lipid-protein interactions of hydrophobic proteins SP-B and SP-C in lung surfactant assembly and dynamics. PMID: 11699574
  41. Data suggest that SMAD3 interactions with the positive regulators NKX2.1 and HNF-3 form the molecular basis for TGF-beta-induced repression of surfactant protein B gene transcription. PMID: 12161428
  42. Differences in N-linked glycosylation between human surfactant protein-B variants of the C or T allele at the single-nucleotide polymorphism at position 1580 have been explored in relation to disease. PMID: 12356334
  43. Studies suggest that polymorphisms in intron 4 of the surfactant protein B gene independently modify the course of neonatal respiratory distress syndrome. PMID: 12424586
  44. An association between SP-B polymorphism and RDS was observed in premature, first-born twins. Specifically, the threonine allele was linked to an increased risk of RDS. PMID: 12483294
  45. Dimeric SP-B(1-25) has been found to be more efficient in restoring lung function in neonatal RDS and ARDS compared to monomeric SP-B(1-25) surfactant. PMID: 12490037
  46. Surfactant protein B expression is regulated by an enhancer region that binds to thyroid transcription factor-1, retinoic acid receptor, signal transducers and activators of transcription 3, nuclear receptor coactivators (SRC-1, ACTR, TIF2, and CBP/p300). PMID: 12573987
  47. Mutations and Polymorphisms in SFTPB have been associated with severe unexplained respiratory distress. PMID: 12784301
  48. SP-B expression is regulated by PPARgamma in the lung. PMID: 12829715
  49. Reduced SP-B expression due to elevated nitric oxide levels can contribute to lung injury. PMID: 12896877
  50. In human lungs, mature SP-B is involved in the structural organization of lamellar bodies and tubular myelin through the formation of core particles. PMID: 12972403

Show More

Hide All

Database Links

HGNC: 10801

OMIM: 178640

KEGG: hsa:6439

STRING: 9606.ENSP00000377409

UniGene: Hs.512690

Involvement In Disease
Pulmonary surfactant metabolism dysfunction 1 (SMDP1); Respiratory distress syndrome in premature infants (RDS)
Subcellular Location
Secreted, extracellular space, surface film.

Q&A

What is the basic structure and function of SFTPB in pulmonary physiology?

SFTPB is a 79-residue hydrophobic polypeptide that belongs to the saposin or saposin-like proteins (SAPLIP) family. It exhibits a tertiary structure incorporating amphipathic helices and turn/bend regions in a "saposin fold" stabilized by intramolecular disulfide linkages. This unique structural arrangement promotes strong interactions with both lipid head groups and fatty chains. Functionally, SFTPB is critical for the biophysical and physiological function of pulmonary surfactant, a phospholipid-protein mixture that lines alveoli at the air-liquid interface. SFTPB helps spread surfactant across the lung tissue surface, lowering surface tension, easing breathing, and preventing alveolar collapse after exhalation .

How does SFTPB interact with other surfactant components to maintain alveolar homeostasis?

SFTPB plays an essential role in surfactant function through multiple mechanisms. It facilitates the spreading of phospholipids across the air-liquid interface in alveoli and contributes to the formation of lamellar bodies, which are specialized cellular structures for surfactant storage and secretion. Importantly, SFTPB influences the processing of surfactant protein-C (SP-C), with studies showing that lack of normal SFTPB leads to abnormal processing of SP-C, resulting in reduction of mature SP-C and accumulation of unprocessed forms. This interconnected relationship explains why SFTPB deficiency manifests with such severe clinical symptoms - it affects not only its direct functions but also disrupts the broader surfactant protein system homeostasis .

What genetic variations are common in the SFTPB gene and how do they impact protein function?

Despite its relatively small genomic size of approximately 9.7 kb, the SFTPB gene (GeneID: 6439) exhibits exceptional genetic complexity. Comprehensive resequencing studies have revealed an excess of low-frequency variations, with at least 81 SNPs and five small insertion/deletions documented. The gene is characterized by weak linkage disequilibrium (LD) and high haplotype diversity, which is attributable to a recombination hot spot that spans the SFTPB gene. Over 30 mutations causing surfactant dysfunction have been identified, with functional consequences ranging from partial to complete loss of mature SFTPB. Notably, homology-based software analysis has not identified definitively damaging common exonic variants, suggesting that disease-causing mutations are typically rare variants rather than common polymorphisms .

What methodological approaches are optimal for studying SFTPB genetic variants in diverse populations?

Due to the unique genetic characteristics of SFTPB—including excess low-frequency variation, intragenic recombination, and lack of common disruptive exonic variants—complete resequencing represents the optimal approach for genetic association studies. Traditional SNP-based approaches that rely on linkage disequilibrium to capture genetic variation are less effective for SFTPB because of the recombination hot spot spanning the gene. When designing studies to identify regulatory SFTPB variants that may contribute to neonatal respiratory distress syndrome or other pulmonary conditions in genetically diverse populations, researchers should consider complete gene sequencing rather than targeted SNP analysis. This approach is particularly important when studying ethnically diverse cohorts, as haplotype structures may vary significantly between populations .

CharacteristicImplication for Research Design
Excess low-frequency variationNeed for large sample sizes to detect rare variant effects
Weak linkage disequilibriumLimited utility of tagging SNPs; need for direct variant detection
Recombination hot spotPotential for novel haplotype combinations affecting gene function
High haplotype diversityPopulation-specific analyses may be required

How do mutations in the SFTPB gene contribute to neonatal respiratory distress syndrome?

Mutations in the SFTPB gene that cause surfactant dysfunction lead to severe, often fatal breathing problems in newborns. These mutations disrupt the normal production of mature SP-B protein, resulting in abnormal composition and decreased function of pulmonary surfactant. The pathophysiological cascade includes impaired lamellar body formation, which in turn causes abnormal processing of SP-C. This combined dysfunction of SP-B and SP-C significantly raises surface tension in the alveoli, causing difficulty breathing and lung collapse. Studies in human newborn infants with rare recessive loss-of-function SFTPB mutations have demonstrated that genetic disruption of SFTPB expression is completely penetrant and lethal due to dysfunction of the pulmonary surfactant. Research indicates that even a partial reduction of SFTPB expression (>75%) is sufficient to disrupt surfactant function and cause respiratory distress .

What is the role of SFTPB in inflammatory lung diseases such as COPD?

Recent research has revealed a potential role for SFTPB in chronic obstructive pulmonary disease (COPD) pathogenesis through inflammatory mechanisms. Clinical studies have shown that serum SFTPB levels are significantly lower in COPD patients compared to healthy controls (p = 0.009). Conversely, inflammatory markers including interleukin-6 (IL-6) and prostaglandin-endoperoxide synthase-2 (PTGS2) are elevated in these patients. In vitro studies using A549 cells exposed to cigarette smoke extract (CSE) demonstrate that SFTPB expression decreases while inflammatory cytokines increase. Mechanistic investigations reveal that overexpression of SFTPB reduces levels of IL-6, IL-8, and PTGS2, while SFTPB silencing produces the opposite effect. This suggests that SFTPB plays a regulatory role in pulmonary inflammation, with its reduction potentially contributing to the inflammatory component of COPD pathogenesis. These findings position SFTPB as a potential key protein for evaluating COPD progression .

What evidence links SFTPB to lung cancer risk assessment?

Longitudinal cohort studies have explored the utility of pro-surfactant protein B (pro-SFTPB) as a potential biomarker for lung cancer risk. Research from the Physicians' Health Study, which included 188 cases and 337 matched controls, demonstrated that plasma levels of pro-SFTPB varied significantly with smoking status and age. Specifically, pro-SFTPB levels were higher among current smokers (+142%, p < 0.001) and former smokers (+21%, p = 0.09) compared to never smokers, and increased with age (+18.1% per 10-year difference, p = 0.02). The mean pro-SFTPB concentration was higher in individuals who eventually developed lung cancer (325.6 ng/ml) compared to those who remained cancer-free (260.8 ng/ml). These findings suggest that circulating pro-SFTPB levels may reflect ongoing pulmonary epithelial injury or dysfunction that precedes clinical detection of lung cancer, potentially serving as a risk biomarker for early detection strategies .

GroupMean pro-SFTPB (ng/ml)SD
Cases (n=188)325.6313.9
Controls (n=337)260.8289.5

How can lung organoids be utilized to study SFTPB function and deficiency?

Patient-specific induced pluripotent stem cell (iPSC)-derived lung organoids represent an advanced model system for studying SFTPB deficiency. This three-dimensional culture system closely replicates human fetal lung development, containing both epithelial and mesenchymal cell populations from proximal and distal airways. The methodology involves generating iPSCs from patient fibroblasts (e.g., those with p.Pro133GlnfsTer95 SFTPB mutation), which can then be differentiated into lung organoids using specialized protocols. Genetic correction can be achieved by introducing wild-type SFTPB via lentiviral vectors prior to organoid differentiation. This approach allows researchers to compare SFTPB-deficient and corrected organoids derived from the same patient, evaluating transcription, translation, and functional aspects of SFTPB biology. The presence of lamellar bodies in alveolar type II cells and secretion of surfactant bioactive lipids can be assessed as functional readouts. This model system overcomes limitations of animal models by providing a human-specific context for studying SFTPB biology and testing potential therapies .

What synthetic approaches exist for creating functional SFTPB analogs?

Based on the known three-dimensional structural motif of the saposin protein family, researchers have developed synthetic peptide constructs that mimic SFTPB structure and function. Notable examples include the 34-residue "Mini-B" (MB) and the 41-residue "Super Mini-B" (S-MB), which replicate the structure of the SP-B leaf containing the N- and C-terminal regions. These constructs are designed based on homology-based models of SP-B that predict disk-like structures containing disulfide-linked, positively charged amphipathic helices. The synthetic approach involves creating disulfide cross-linked peptides that maintain the key structural features necessary for surfactant activity. Both MB and S-MB have demonstrated high surfactant activities in in vitro and in vivo assays, suggesting they could serve as effective components in synthetic lung surfactants. This bioengineering approach represents a promising strategy for developing therapeutic surfactants that avoid the need for animal-derived materials while maintaining essential functional properties of the native protein .

How do SFTPB genetic variants interact with other surfactant protein genes in respiratory diseases?

Genetic association studies have revealed complex interactions between SFTPB variants and other surfactant protein genes in respiratory diseases such as cystic fibrosis (CF). Research examining disease severity subgroups (mild and moderate/severe) identified a single SFTPB SNP (rs7316) that associates with mild CF after Bonferroni correction. This SNP, located within the 3′UTR, may affect regulation of polyadenylation. Particularly notable are the intergenic interactions between SFTPB SNPs and SNPs of genes encoding hydrophilic surfactant proteins. Of eight significant intergenic interactions identified in CF subgroups, seven were for the mild CF group, with the rs7316 SNP being the only SFTPB SNP that interacted with SNPs of SFTPA1 or SFTPA2. Different patterns of SNP-SNP interactions suggest that the mechanisms through which hydrophilic proteins contribute to mild CF may differ. These findings indicate the importance of considering not just individual gene variants but also gene-gene interactions when studying the genetic basis of respiratory diseases .

What are the current methodological challenges in producing functional recombinant SFTPB for therapeutic applications?

Producing functional recombinant SFTPB presents several methodological challenges due to the protein's unique structural properties. The hydrophobic nature of SFTPB, combined with its complex disulfide bond pattern, makes traditional recombinant expression systems suboptimal. Additional challenges include ensuring proper post-translational modifications and maintaining the protein's amphipathic character. Current approaches to overcome these limitations include:

  • Development of synthetic peptide analogs like Mini-B (MB) and Super Mini-B (S-MB) that capture essential structural features while being more amenable to synthesis

  • Gene therapy approaches using viral vectors to deliver functional SFTPB genes

  • Cell-based production systems in which recombinant SFTPB is expressed in mammalian cells capable of proper protein processing

  • Organoid-based systems that can produce SFTPB in a physiologically relevant context

Each approach has specific advantages and limitations related to scalability, functional equivalence to native SFTPB, and clinical applicability. The optimal methodology depends on the intended research or therapeutic application .

How can SFTPB regulation be targeted in inflammatory pulmonary conditions?

Research indicates that SFTPB plays a regulatory role in pulmonary inflammation, suggesting potential therapeutic strategies targeting SFTPB regulation in inflammatory pulmonary conditions. Experimental findings demonstrate that dexamethasone treatment increases SFTPB levels in cell culture models, suggesting that anti-inflammatory corticosteroids may exert part of their therapeutic effect through SFTPB upregulation. Mechanistic studies reveal a relationship between SFTPB and inflammatory mediators, with SFTPB overexpression reducing levels of IL-6, IL-8, and PTGS2. This relationship appears bidirectional, as inflammatory conditions induced by cigarette smoke extract reduce SFTPB expression. These findings suggest multiple potential intervention points:

  • Direct supplementation with recombinant SFTPB or synthetic analogs

  • Pharmacological upregulation of endogenous SFTPB expression

  • Targeting the SFTPB-PTGS2 inflammatory axis

  • Combined approaches addressing both SFTPB deficiency and downstream inflammatory pathways

Methodologically, researchers should consider comprehensive experimental designs that evaluate both SFTPB expression and inflammatory marker profiles when testing potential therapies for conditions like COPD .

What emerging technologies might advance SFTPB research in the next decade?

Emerging technologies likely to advance SFTPB research include:

  • Single-cell transcriptomics for studying cell-specific SFTPB expression patterns

  • CRISPR-Cas9 gene editing for precise manipulation of SFTPB in cellular and organoid models

  • Advanced lung-on-chip microfluidic systems that better recapitulate the alveolar microenvironment

  • Computational modeling approaches to predict functional consequences of SFTPB variants

  • Long-read sequencing technologies for better characterization of the complex recombination patterns in the SFTPB gene

These technologies will enable more precise understanding of SFTPB regulation, processing, and function at molecular, cellular, and systemic levels, potentially leading to novel therapeutic strategies for surfactant-related disorders .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.