Recombinant Human Putative claudin-25 (CLDN25)

Shipped with Ice Packs
In Stock

Description

Research Applications

Recombinant CLDN25 is pivotal in studying:

  • Tight Junction Dynamics: CLDN25 disrupts TJ strand formation when overexpressed, acting as a "decoy claudin" to modulate paracellular permeability .

  • Disease Models:

    • Leukodystrophy: A de novo A249P mutation in CLDN25 causes haploinsufficiency linked to Pelizaeus-Merzbacher-like disease .

    • Cancer: Altered CLDN25 expression correlates with tumor progression, though mechanisms remain unclear .

  • Antibody Validation: The recombinant protein fragment (aa 49–73) is used to block anti-CLDN25 antibodies in immunohistochemistry .

Key Findings

  • Localization Mechanism: CLDN25 requires its C-terminal domain (but not ZO-1 binding) for junctional localization. Deletion or point mutations (e.g., A249P) abolish this localization, leading to functional deficits .

  • Barrier Regulation: Knockout studies suggest CLDN25 paradoxically enhances solute movement while increasing TJ integrity, indicating a role in dynamic barrier modulation .

  • Interaction Partners: TMEM25, a TJ protein, inhibits CLDN25 assembly by binding its extracellular domain, highlighting regulatory cross-talk among claudins .

Future Directions

  • Therapeutic Targets: CLDN25’s role in myelination and epilepsy warrants exploration using iPSC-derived oligodendrocytes .

  • Cancer Biomarkers: Further studies are needed to clarify its dual role in tumor suppression/progression .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CLDN25; Putative claudin-25
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CLDN25
Target Protein Sequence
MAWSFRAKVQLGGLLLSLLGWVCSCVTTILPQWKTLNLELNEMETWIMGIWEVCVDREEV ATVCKAFESFLSLPQELQVARILMVASHGLGLLGLLLCSFGSECFQFHRIRWVFKRRLGL LGRTLEASASATTLLPVSWVAHATIQDFWDDSIPDIIPRWEFGGALYLGWAAGIFLALGG LLLIFSACLGKEDVPFPLMAGPTVPLSCAPVEESDGSFHLMLRPRNLVI
Uniprot No.

Target Background

Function

Plays a major role in tight junction-specific obliteration of the intercellular space through calcium-independent cell-adhesion activity.

Database Links

HGNC: 37218

KEGG: hsa:644672

STRING: 9606.ENSP00000396304

UniGene: Hs.705360

Protein Families
Claudin family
Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and cellular localization of CLDN25?

CLDN25 (putative claudin-25) is a transmembrane protein belonging to the claudin superfamily. Like other claudins, it is predicted to have four transmembrane domains with N- and C-terminal cytoplasmic domains and two extracellular loops. The calculated molecular weight of CLDN25 is approximately 25 kDa, although the observed molecular weight may vary due to post-translational modifications . The protein primarily localizes to cell junctions, specifically tight junctions, and is embedded in the cell membrane . Western blot analysis often shows multiple bands for claudins due to different modified forms occurring simultaneously, which may cause the observed band size to be inconsistent with the expected size .

What expression systems are optimal for producing functional recombinant CLDN25?

Based on successful expression of other claudin family members, particularly claudin-1, several expression systems can be considered for CLDN25:

  • Yeast Expression System: The methylotrophic yeast Pichia pastoris has been successfully used to express full-length human claudin-1 in milligram quantities . This system allows proper folding and oligomerization of membrane proteins, making it suitable for claudins. When expressed in P. pastoris, claudin-1 formed various oligomeric states comparable to those observed in mammalian cells .

  • Mammalian Expression Systems: For studies requiring native post-translational modifications and conformational epitopes, mammalian systems such as HEK293 cells can be employed. These systems are particularly useful when studying claudin interactions with other mammalian proteins .

The choice of expression system should be guided by the specific experimental requirements, including the need for post-translational modifications, protein yield, and downstream applications.

What purification strategies yield functional CLDN25 suitable for biochemical studies?

Purification strategies for claudin family proteins typically involve:

  • Detergent Extraction: The choice of detergent significantly impacts the oligomeric state of the purified protein. For instance, with claudin-1:

    • n-octyl-β-d-glucopyranoside (βOG) extraction yields monodispersed, dimeric protein

    • Profoldin-8 or n-decylphosphocholine (foscholine-10) extraction results in dynamic mixtures of oligomers

  • Affinity Purification: For tagged recombinant claudins, affinity purification can be employed. For antibody production, antigen affinity purification has been successfully used for CLDN25 antibodies .

  • Size Exclusion Chromatography: This technique can separate different oligomeric forms of claudins and assess protein homogeneity.

How can researchers verify the proper folding and functionality of recombinant CLDN25?

Several approaches can validate the proper folding and functionality of recombinant CLDN25:

  • Conformation-Dependent Antibody Binding: Using antibodies that recognize native conformational epitopes can confirm proper protein folding. For example, claudin-1 expressed in yeast was verified using conformation-dependent antibodies through flow cytometry and confocal imaging of protoplasts .

  • Oligomerization Analysis: Native PAGE, crosslinking studies, or analytical ultracentrifugation can assess whether recombinant CLDN25 forms the expected oligomeric structures.

  • Functional Reconstitution: Incorporating purified CLDN25 into proteoliposomes and testing their interaction with other tight junction components or their ability to form paracellular barriers can validate functionality.

What methods are most effective for studying CLDN25 interactions with other tight junction proteins?

Based on methodologies used for other claudin family members, the following approaches can be applied to study CLDN25 interactions:

  • Co-Immunoprecipitation (Co-IP): This technique can identify protein-protein interactions in both cell lysates and in vitro with purified proteins. For example, claudin-1 interactions with TMEM25 were studied using Co-IP, revealing both cis and trans interactions .

  • Reconstitution Assays: Purified proteins can be reconstituted into liposomes to study their interactions and functional properties in a membrane environment .

  • Cell-Based Assays: Co-culture experiments with cells expressing different tagged proteins can reveal trans-interactions across cell membranes. This approach was used to demonstrate that TMEM25 trans-interacts with claudin-1 in an extracellular region-dependent manner .

  • Microscopy Techniques: Immunofluorescence and confocal microscopy can visualize co-localization of CLDN25 with other tight junction proteins. For claudins expressed in HEK293 cells (which lack endogenous claudins), accumulation at cell-cell contact sites indicates successful trans-oligomerization and strand formation .

How does CLDN25 contribute to tight junction assembly and function?

While specific information about CLDN25's role in tight junction assembly is limited, insights from other claudins suggest that:

  • Claudin Assembly: Claudins form both cis-interactions (within the same membrane) and trans-interactions (between adjacent cells), which are essential for tight junction strand formation .

  • Regulation by Partner Proteins: Proteins like TMEM25 can regulate claudin assembly by interacting with claudins and preventing their cis and trans oligomerization . For example, TMEM25 specifically attenuates claudin assembly and subsequent strand formation, while its interaction with polarity protein Par3 modulates this regulatory function .

  • Barrier Function: Claudins establish the paracellular barrier that prevents solutes and water from passing freely between epithelial or endothelial cells, thereby maintaining tissue homeostasis .

Based on these observations in other claudins, CLDN25 likely contributes to tight junction integrity through similar mechanisms of assembly and regulation.

What regulatory proteins are known to modulate CLDN25 function?

While specific regulatory partners of CLDN25 are not detailed in the provided information, studies of related claudins indicate several potential regulatory mechanisms:

  • Polarity Proteins: Par3, a key polarity protein, interacts with TMEM25, which in turn regulates claudin assembly . This suggests that polarity complex proteins may indirectly regulate CLDN25 function through similar intermediaries.

  • Membrane Proteins: TMEM25 has been shown to interact with claudin-1 and claudin-2, preventing their assembly and subsequent strand formation . Similar regulatory proteins may interact with CLDN25 to modulate its function in tight junctions.

  • Signaling Pathways: Claudins participate in signal transduction pathways , suggesting that CLDN25 may be regulated by various kinases and phosphatases that modify its phosphorylation status.

How can recombinant CLDN25 be utilized to study epithelial and endothelial barrier dysfunction?

Recombinant CLDN25 can be employed in several experimental approaches to investigate barrier dysfunction:

  • Proteoliposome Studies: Purified CLDN25 reconstituted into proteoliposomes can be used to study its role in barrier formation and permeability. Similar approaches with claudin-1 provided insights into its interaction with CD81 and role in HCV infection .

  • Cell Line Models: Overexpression or depletion of CLDN25 in epithelial or endothelial cell lines can reveal its specific contributions to barrier function. For example, studies with TMEM25 showed that its depletion accelerated tight junction formation in MDCK cells after calcium switch, while its overexpression prevented tight junction formation .

  • 3D Culture Systems: Three-dimensional culture systems, such as cyst formation assays with MDCK cells, can demonstrate the significance of tight junction proteins in establishing cell polarity and tissue architecture . Similar approaches could be applied to study CLDN25's role in epithelial organization.

What are the implications of CLDN25 research for understanding disease pathophysiology?

Research on claudins has broad implications for disease pathophysiology:

  • Infectious Diseases: Some claudins serve as entry factors for pathogens, as exemplified by claudin-1's role in Hepatitis C Virus (HCV) infection through its interaction with CD81 . Investigation of CLDN25 may reveal similar roles in other infectious diseases.

  • Epithelial Disorders: Dysregulation of tight junctions is implicated in numerous conditions, including inflammatory bowel disease, celiac disease, and various epithelial cancers. Understanding CLDN25's role could provide insights into these pathologies.

  • Barrier Dysfunction Syndromes: Conditions characterized by increased paracellular permeability, such as certain autoimmune diseases and allergic disorders, may involve alterations in claudin expression or function. CLDN25 research could contribute to understanding these conditions.

What experimental challenges must be addressed when studying membrane proteins like CLDN25?

Several challenges must be overcome when working with membrane proteins like CLDN25:

  • Protein Stability: Maintaining the stability of membrane proteins during extraction and purification is challenging. The choice of detergent is critical, as demonstrated with claudin-1, where different detergents yielded proteins with varying oligomeric states .

  • Native Conformation: Ensuring that recombinant proteins maintain their native conformation is essential for functional studies. Verification methods such as binding of conformation-dependent antibodies can address this concern .

  • Reconstitution Systems: For functional studies, membrane proteins often need to be reconstituted into artificial membrane systems. The composition of these systems can significantly impact protein behavior and must be carefully optimized.

  • Oligomeric State Analysis: Claudins form various oligomeric states that are crucial for their function. Techniques such as analytical ultracentrifugation and native PAGE are necessary to characterize these states accurately .

What antibody selection criteria are important for CLDN25 detection and characterization?

When selecting antibodies for CLDN25 research, several factors should be considered:

  • Specificity: Antibodies should be validated for specificity against CLDN25, ideally with verification in relevant tissues like human lung, where CLDN25 antibodies have been verified .

  • Application Compatibility: Ensure the antibody is validated for your specific application (e.g., Western blotting, immunofluorescence, flow cytometry). The CLDN25 polyclonal antibody described in the search results is validated for Western blotting at dilutions of 1:500-1:2000 .

  • Epitope Recognition: Consider whether conformational epitopes are important for your research. Conformation-dependent antibodies are valuable for verifying proper protein folding .

  • Host Species: The host species of the antibody (e.g., rabbit IgG for the CLDN25 antibody described) should be compatible with your experimental design, particularly for co-staining with other antibodies .

  • Storage and Handling: Proper storage conditions (-20°C for the described CLDN25 antibody) and avoiding freeze/thaw cycles are crucial for maintaining antibody activity .

How can researchers optimize experimental conditions for studying CLDN25-mediated tight junction formation?

Optimizing experimental conditions for CLDN25 research requires attention to several factors:

  • Cell Model Selection: Choose appropriate cell models, such as:

    • Epithelial cell lines (MDCK, Caco-2) for studying physiological tight junction formation

    • Claudin-deficient cells (HEK293, L cells) for reconstitution experiments to study specific claudin functions without interference from endogenous claudins

  • Calcium Switch Assays: These assays, which involve calcium depletion followed by repletion to trigger tight junction formation, can reveal the dynamics of CLDN25 incorporation into tight junctions .

  • 3D Culture Systems: Three-dimensional culture systems, such as cyst formation assays, provide insights into the role of tight junction proteins in epithelial organization and polarity .

  • Co-expression Studies: Co-expressing CLDN25 with potential regulatory partners can help identify factors that modulate its function in tight junction assembly.

  • Detergent Selection: For biochemical studies, the choice of detergent significantly impacts protein properties. Testing multiple detergents, as was done for claudin-1 (βOG, profoldin-8, foscholine-10), can help identify conditions that maintain the desired protein characteristics .

What bioinformatic tools can predict functional domains and interaction sites in CLDN25?

Several bioinformatic approaches can provide insights into CLDN25 structure and function:

  • Sequence Analysis Tools: Programs that predict transmembrane domains, signal peptides, and potential post-translational modification sites can identify functional regions of CLDN25.

  • Protein Domain Prediction: Tools that identify conserved domains can highlight regions shared among claudin family members, suggesting functional importance.

  • Phosphorylation Site Prediction: Since phosphorylation often regulates tight junction proteins, prediction tools for potential phosphorylation sites can identify regulatory regions in CLDN25.

  • Protein-Protein Interaction Prediction: Based on known interactions of other claudins, computational methods can predict potential CLDN25 interaction partners.

  • Homology Modeling: Using the structures of better-characterized claudins as templates, homology modeling can predict the three-dimensional structure of CLDN25, providing insights into its functional domains and interaction surfaces.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.