Recombinant Human Putative dimethylaniline monooxygenase [N-oxide-forming] 6 (FMO6P)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Human Putative Dimethylaniline Monooxygenase [N-Oxide-Forming] 6 (FMO6P) is a pseudogene belonging to the flavin-containing monooxygenase (FMO) family . FMO6P is located close to the FMO3 gene and shares significant sequence homology with other FMOs .

Gene Information

The National Center for Biotechnology Information (NCBI) provides detailed information on the FMO6P gene, also known as flavin containing dimethylaniline monoxygenase 6 . GeneCards offers extensive information regarding the FMO6P gene, including its function, associated proteins, and related disorders .

Genetic Studies and Nicotine Dependence

A study investigated the genetic effects of FMO genes, including FMO1, FMO3, and FMO6P, on nicotine dependence. The study utilized targeted sequencing to identify genetic polymorphisms of flavin-containing monooxygenases in individuals with varying degrees of nicotine dependence .

FMO Family

The flavin-containing monooxygenase (FMO) family comprises enzymes that catalyze the oxygenation of various drugs, xenobiotics, and endogenous compounds . FMO6P is a pseudogene, and five functional FMO forms have been identified in humans .

Association with Cardiovascular Disease

The Cardiovascular Disease Knowledge Portal provides gene-level association scores for FMO6P based on exome sequencing and whole-genome sequencing studies . This information can be used to explore potential links between FMO6P and cardiovascular disease .

Pharmacogenetics Findings for Paclitaxel

A study aimed to determine the reproducibility of pharmacogenetics findings for paclitaxel in a heterogeneous population of patients with lung cancer. The study involved genotyping to assess allelic variants in pharmacogenes and analyzing their relationships with progression-free survival and toxicity. The Drug Metabolizing Enzymes and Transporters platform (DMET) array, which ascertains 1931 allelic variants in 235 pharmacogenes, was used .

Table 1: Genotype versus Progression-Free Survival (PFS)

VariantP-value (Cox Regression)P-value (Exact Trend Test)P-value (Combined Categories)
SNPs with P<0.05724411 (P<0.01)

Table 2: Genotype versus Toxicity

SNPP-value (2x2)P-value (2x3)
rs46790280.004NA
rs4643786NA<0.01
rs910795NA<0.01
rs6811453NA<0.01
rs6577NA<0.01
rs1056836NA<0.01
rs3093105NA<0.01
rs2884737NA<0.01

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FMO6P; FMO6; Putative dimethylaniline monooxygenase [N-oxide-forming] 6; Dimethylaniline oxidase 6; Flavin-containing monooxygenase 6; FMO 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-539
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
FMO6P
Target Protein Sequence
MSKRVGIIGAGVSGLAAIWCCLEEGLEPTCFERSDDVGGLWKFSDHTEEGRASIYQSVFT NSSKEMMCFPDFPYPDDYPNYIHHSKLQEYIKTYAQKKDLLRYIQFETLVSGIKKCPSFL VTGQWVVVTEKDGKQESTIFDAVMICSGHHVYPNLPTDSFPGLDQFRGNYLHSRDYKNPE AFKGKRVLVIGLGNSGSDIAVELSRLATQVIISTRSASWVMSRVWDDGYPWDMMYVTRFA SFLRNVLPSFISDWLYVQKMNTWFKHENYGLMPLNGSLRKEPVFNDELPSRILCGTLSIK PSVKEFTETSAVFEDGTMFEAIDSVIFATGYDYSYPFLDETIMKSRNNEVTLFKGIFPPL MEKPTLAVIGLVQSLGAAIPTADLQAWWAAKVFANSCTLPTTNEMMDDTDEKMGKKLKCM FSSFFMFGQSQTLQTDYITYVDELGSFIGAKPNIPWLFLTDPRLALEVYFGPCSPYQFRL MGPGKWDGARNAILTQWNRTVKPTRTRVVSEVQRPHPFYNLLKMLSFPLLLLAVTLTFY
Uniprot No.

Target Background

Function

It is likely that this protein is produced in very small quantities or not at all, as the gene appears to be unable to generate full-length transcripts.

Database Links

HGNC: 24024

Protein Families
FMO family
Subcellular Location
Microsome membrane; Single-pass membrane protein. Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is FMO6P and how does it relate to other FMO family members?

FMO6P (Putative dimethylaniline monooxygenase [N-oxide-forming] 6) is a member of the flavin-containing monooxygenase (FMO) enzyme family. In humans, six FMO genes have been identified (FMO1-6), with FMO1 and FMO3 being the most extensively characterized . FMO6P shares structural features common to FMO enzymes, including the conserved FMO sequence motif (FXGXXXHXXXF/Y) and binding domains for flavin adenine dinucleotide (FAD) and nicotinamide adenine dinucleotide phosphate (NADPH) . Unlike the well-established metabolic roles of FMO1 and FMO3, the functional significance of FMO6P remains largely uncharacterized in human metabolism.

Why is FMO6P classified as "putative" and what implications does this have for research?

FMO6P is classified as "putative" because while the gene has been identified at the genomic level, there has been limited definitive evidence of its functional expression as an active protein in human tissues. Based on research approaches used for other FMO isoforms, investigators should consider multiple methodological approaches to confirm FMO6P expression, including Western blotting with isoform-specific antibodies, transcript analysis via RT-PCR, and functional enzyme assays . Research designs should incorporate proper controls and consider the possibility that FMO6P may be expressed in a highly tissue-specific or developmental stage-specific manner, similar to the patterns observed with FMO1 and FMO3 .

What expression systems are most appropriate for producing recombinant human FMO6P?

For recombinant expression of human FMO6P, several expression systems can be considered based on successful approaches with other FMO isoforms:

  • Bacterial Expression Systems: Escherichia coli has been successfully used for recombinant expression of bacterial FMOs such as the trimethylamine monooxygenase (Tmm) from Methylocella silvestris . When expressing human FMO6P in bacterial systems, researchers should optimize codon usage and consider using specialized strains designed for expression of eukaryotic proteins.

  • Mammalian Cell Lines: For more native post-translational modifications, mammalian cell lines may provide advantages, particularly when studying interactions with other human proteins or regulatory factors.

  • Baculovirus/Insect Cell Systems: These often provide a good compromise between proper protein folding and higher expression yields for human enzymes.

The selection of an appropriate expression system should be guided by the specific research questions, with consideration for protein solubility, activity retention, and post-translational modifications.

What are the recommended methods for assessing FMO6P enzymatic activity?

Based on established methodologies for other FMO family members, the following approaches can be applied to assess FMO6P activity:

  • Spectrophotometric Assays: Monitoring NADPH consumption during substrate oxidation.

  • HPLC/LC-MS Analysis: Quantifying metabolite formation from known FMO substrates such as trimethylamine, thioureas, or sulfides.

  • Oxygen Consumption Measurements: Using oxygen electrodes to measure oxygen utilization during catalytic cycles.

Researchers should consider testing FMO6P against substrates known to be metabolized by other FMO isoforms, including trimethylamine, which serves as a substrate for bacterial FMO (Tmm) , and various therapeutic compounds that are substrates for human FMO1 and FMO3 .

How should researchers approach tissue-specific expression analysis of FMO6P?

When investigating tissue-specific expression of FMO6P, researchers should:

  • Perform Multi-Tissue Screening: Examine expression across diverse tissue types, not limited to liver, as FMOs may show tissue-specific patterns.

  • Consider Sex Differences: While FMO3 shows gender-independent increase during adolescence , other FMOs might exhibit sex-specific expression patterns.

  • Account for Interindividual Variation: The 2-20 fold interindividual variation observed in FMO1 and FMO3 protein levels suggests that FMO6P might also show significant variation between individuals. Therefore, studies should include adequate sample sizes and consider genetic polymorphisms.

What approaches can identify potential substrates for FMO6P?

To identify potential FMO6P substrates, researchers should consider multiple complementary approaches:

  • Substrate Panel Screening: Test compounds known to be metabolized by other FMO family members, including:

    • Trimethylamine and related compounds

    • Thioether-containing organophosphorous pesticides

    • Sulfur and nitrogen-containing drugs and xenobiotics

    • Endogenous compounds like cysteamine and methionine

  • Competitive Inhibition Studies: Use known FMO substrates in competition assays to characterize binding pocket similarities between FMO6P and other FMO isoforms.

  • Structural Modeling: Employ homology modeling based on other FMO crystal structures to predict substrate binding characteristics.

  • Metabolomic Screening: Compare metabolite profiles between systems expressing FMO6P and control systems to identify potential endogenous substrates.

How can researchers distinguish between functional activity and pseudogene characteristics of FMO6P?

To address the functional status of FMO6P, researchers should implement a multi-faceted approach:

  • Comparative Sequence Analysis: Analyze the FMO6P sequence for premature stop codons, frameshift mutations, or other features that might suggest pseudogene status.

  • Transcriptional Analysis:

    • Perform RT-PCR with isoform-specific primers

    • Conduct 5' and 3' RACE to characterize full-length transcripts

    • Analyze alternate splicing patterns that might generate functional variants

  • Functional Reconstitution: Express the recombinant protein and assess activity using multiple substrate probes and assay conditions.

  • Mutagenesis Studies: Perform site-directed mutagenesis of key catalytic residues to confirm structure-function relationships consistent with enzymatic activity.

What are the key technical challenges in studying recombinant FMO6P?

Researchers face several technical challenges when working with recombinant FMO6P:

  • Protein Instability: FMO enzymes often show thermal instability when isolated from their native environment. Stabilization strategies may include:

    • Addition of detergents or phospholipids to mimic membrane environment

    • Use of NADPH and FAD during purification

    • Optimization of buffer conditions to maintain protein stability

  • Assay Sensitivity: Given potentially low catalytic activity, highly sensitive detection methods may be required:

    • LC-MS/MS for metabolite detection

    • Radiometric assays with labeled substrates

    • Amplified detection systems for redox cycling

  • Distinguishing from Other FMOs: Ensuring specificity when measuring FMO6P activity in complex systems:

    • Use of selective inhibitors for other FMO isoforms

    • Isoform-specific antibodies for immunodepletion studies

    • Expression in systems lacking endogenous FMO activity

How should researchers address potential contradictory data in FMO6P functional studies?

When facing contradictory data regarding FMO6P function:

  • Standardize Experimental Conditions: Variations in pH, temperature, salt concentration, and cofactor availability can significantly affect FMO activity.

  • Consider Genetic Variants: Polymorphisms might explain contradictory findings between different population samples.

  • Examine Splice Variants: Alternative splicing can produce multiple protein variants with different functional characteristics.

  • Evaluate Post-Translational Modifications: Phosphorylation, glycosylation, or other modifications may regulate activity.

  • Systematic Documentation of Negative Results: Maintain detailed records of negative findings to help identify patterns in conditions under which activity is observed or absent.

What approaches can elucidate the physiological relevance of FMO6P?

For investigating the physiological significance of FMO6P:

  • Comparative Expression Studies: Analyze FMO6P expression in disease states versus healthy conditions using techniques like:

    • RNA sequencing

    • Quantitative proteomics

    • Tissue microarrays

  • Genetic Association Studies: Examine correlations between FMO6P genetic variants and metabolic phenotypes or disease susceptibility.

  • Knockout/Knockdown Models: Develop cell lines or animal models with reduced or eliminated FMO6P expression to observe phenotypic consequences.

  • Pathway Analysis Tools: Utilize bioinformatics resources like Ingenuity Pathway Analysis (IPA) to analyze FMO6P in the context of larger biological networks .

How can researchers investigate potential regulatory mechanisms controlling FMO6P expression?

To explore regulatory mechanisms for FMO6P expression:

  • Promoter Analysis: Characterize the promoter region to identify potential transcription factor binding sites.

  • Epigenetic Regulation: Investigate DNA methylation patterns and histone modifications in the FMO6P gene region across different tissues and developmental stages.

  • Hormonal Regulation: Test effects of various hormones on FMO6P expression, given the developmental patterns observed in other FMO isoforms .

  • Stress Response Elements: Examine whether cellular stressors (oxidative stress, xenobiotic exposure) regulate FMO6P expression as potential adaptive responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.