Recombinant Human Putative EGF-like module-containing mucin-like hormone receptor-like 4 (EMR4P)

Shipped with Ice Packs
In Stock

Description

Introduction to EMR4P

The EGF module-containing Mucin-like hormone Receptors (EMRs) form a closely related subgroup of G protein-coupled receptors (GPCRs) characterized by their unique hybrid structure . EMR4P (also known as GPR127 or PGR16) belongs to this family, which includes EMR1, EMR2, and EMR3 . While EMR4P is functional in other vertebrates including non-human primates, the human version contains a nucleotide deletion in the genomic sequence that results in a frameshift and early termination of translation . This alteration means that any protein expressed from the human EMR4P gene would be soluble rather than membrane-bound, though no endogenous expression has been definitively detected . The gene is classified as a transcribed pseudogene, making recombinant production particularly valuable for comparative studies.

The EMR family is predominantly expressed in cells of the immune system and is thought to play important roles in leukocyte adhesion and migration . Understanding the putative structure and function of EMR4P through recombinant production provides insights into immune system evolution and potentially lost immune functions in humans.

Gene Location and Nomenclature

EMR4P is located on human chromosome 19p13.3, in close proximity to other members of the EMR family . The official gene symbol is ADGRE4P (adhesion G protein-coupled receptor E4, pseudogene), though it is commonly referred to as EMR4P in the literature . Alternative names include EMR4, FIRE, GPR127, and PGR16 .

Expression Systems for Recombinant Production

Recombinant human EMR4P is primarily produced in two expression systems as evidenced by commercial products:

Table 1: Expression Systems for Recombinant Human EMR4P Production

Expression SystemTag OptionsProtein LengthApplicationsSource
E. coliHis-tag (N-terminal)Full length (15-457aa)Structural and functional studies
Wheat GermGST-tag (N-terminal)Partial (21-93aa)Antibody production, ELISA, Western blot

The E. coli expression system is preferred for producing larger quantities of the protein for structural and biochemical analyses, while the wheat germ expression system appears to be used for producing partial fragments that maintain specific epitopes for antibody production .

Expression and Purification Methods

Although specific purification protocols for EMR4P are not detailed in the available literature, insights can be drawn from related EGF family proteins. These typically involve:

  1. Cloning the gene fragment into an expression vector with appropriate tags

  2. Transformation into expression hosts (E. coli or wheat germ)

  3. Induction of protein expression

  4. Cell lysis and extraction

  5. Affinity chromatography using the His-tag or GST-tag

  6. Quality control testing via SDS-PAGE

The purified protein is often supplied in a buffered solution containing stabilizers such as trehalose to maintain integrity during storage . For example, His-tagged EMR4P is typically stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

Quality Control and Characterization

Commercially available recombinant EMR4P undergoes quality control testing primarily through SDS-PAGE to verify purity, which typically exceeds 90% . Further characterization might include:

  1. Mass spectrometry to confirm molecular weight

  2. Western blotting with specific antibodies

  3. Circular dichroism to assess secondary structure

  4. Limited proteolysis to evaluate stability

These methods ensure the recombinant protein's structural integrity and purity before use in downstream applications.

Antibodies and Detection Systems

Several monoclonal antibodies against human EMR4P are commercially available for research applications:

Table 3: Anti-EMR4P Antibodies

CloneIsotypeApplicationsImmunogenSource
1G10IgG2a κWestern blot (1-5 μg/mL), ELISA, ICC/IFPartial recombinant protein (21-93aa)
2H8IgGWestern blot, ELISAPartial recombinant protein (21-93aa) with GST tag

These antibodies serve as critical tools for detecting and studying EMR4P in experimental systems, despite the absence of endogenous expression in human tissues.

Research Applications

Recombinant human EMR4P and related tools are utilized in various research contexts:

  1. Comparative studies with functional EMR4 from other species

  2. Investigation of EGF-TM7 receptor family evolution

  3. Development of detection methods for possible aberrant expression in disease states

  4. Structure-function analysis of EGF-like domains

  5. Antibody production for immunological studies

Comparative Analysis with Other EMR Family Members

Table 4: Comparison of Human EMR Family Members

PropertyEMR1EMR2EMR3EMR4P
Chromosomal Location19p13.319p13.119p13.119p13.3
Functional StatusFunctionalFunctionalFunctionalPseudogene
ExpressionMyeloid cellsMyeloid cellsNeutrophils, monocytes, macrophagesNot detected (pseudogene)
EGF-like DomainsMultipleMultipleTwoTwo (in recombinant form)

Evolutionary Significance

The pseudogenization of EMR4 in humans while remaining functional in other primates presents an interesting evolutionary case. This suggests either:

  1. A loss of function that was not detrimental to survival

  2. A potential adaptive advantage in losing EMR4 function

  3. Genetic drift leading to random loss of function

Comparative studies using recombinant human EMR4P alongside functional EMR4 from other species may illuminate the selective pressures that led to this evolutionary divergence.

Potential Functions Based on Other EMR Family Members

Although human EMR4P is a pseudogene, insights about its potential functions can be gleaned from other EMR family members:

  1. Cell Adhesion and Migration: EMR family members are involved in leukocyte adhesion and migration processes

  2. Immune Regulation: EMR3 has been shown to interact with ligands on monocyte-derived macrophages and activated neutrophils

  3. Cell-Cell Interactions: EMR4 in mice mediates cellular interactions between myeloid cells and B-cells

These functions suggest that before pseudogenization, EMR4 may have played important roles in immune cell interactions and regulation in human ancestors.

Future Research Directions

Several promising research directions involving recombinant human EMR4P include:

  1. Structural analysis to compare with functional EMR4 from other species

  2. Identification of potential binding partners using recombinant EMR4P as bait

  3. Investigation of potential reactivation or expression in pathological conditions

  4. Development of more sensitive detection methods for possible low-level expression

  5. Exploring therapeutic applications based on related functional family members

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery estimates.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice packaging, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing that tag for you.
Synonyms
ADGRE4P; EMR4; EMR4P; GPR127; PGR16; Putative adhesion G protein-coupled receptor E4P; EGF-like module receptor 4; EGF-like module-containing mucin-like hormone receptor-like 4; G-protein coupled receptor 127; G-protein coupled receptor PGR16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
15-457
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
CPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAYCRNK VGGYICSCLVKYTLFNFLAGIIDYDHPDCYENNSQGTTQSNVDIWVSGVKPGFGKQLPGD KRTKHICVYWEGSEGGWSTEGCSHVHSNGSYTKCKCFHLSSFAVLVALAPKEDPVLTVIT QVGLTISLLCLFLAILTFLLCRPIQNTSTSLHLELSLCLFLAHLLFLTGINRTEPEVLCS IIAGLLHFLYLACFTWMLLEGLHLFLTVRNLKVANYTSTGRFKKRFMYPVGYGIPAVIIA VSAIVGPQNYGTFTCWLKLDKGFIWSFMGPVAVIILINLVFYFQVLWILRSKLSSLNKEV STIQDTRVMTFKAISQLFILGCSWGLGFFMVEEVGKTIGSIIAYSFTIINTLQGVLLFVV HCLLNRQVRLIILSVISLVPKSN
Uniprot No.

Target Background

Function
May mediate cellular interaction between myeloid cells and B-cells.
Database Links

HGNC: 19240

UniGene: Hs.688043

Protein Families
G-protein coupled receptor 2 family, Adhesion G-protein coupled receptor (ADGR) subfamily
Subcellular Location
[Isoform 1]: Cell membrane; Multi-pass membrane protein.; [Isoform 2]: Secreted.

Q&A

What is EMR4P and how is it classified among receptor families?

EMR4P belongs to the Class B G protein-coupled receptor (GPCR) family, specifically within the adhesion GPCR subfamily. According to the International Union of Basic and Clinical Pharmacology (IUPHAR) classification system, EMR4P is designated as an orphan receptor, meaning its endogenous ligand remains unidentified despite structural characterization . The receptor contains EGF-like modules and mucin-like domains characteristic of adhesion GPCRs, which typically function in cell-cell and cell-matrix interactions. These structural features align with its proposed role in immune cell adhesion processes.

Functionally, EMR4P has been associated with leukocyte adhesion mechanisms based on multiple independent studies . Within the broader GPCR classification, EMR4P belongs to a subset of receptors for which considerable research effort is being directed toward identifying cognate ligands and validating preliminary pairings reported in single publications.

What expression patterns of EMR4P have been documented across different tissues and disease states?

EMR4P demonstrates tissue-specific and disease-associated expression patterns that provide insights into its physiological and pathological roles. Transcriptomic analyses across multiple independent cohorts have revealed consistent EMR4P overexpression in peripheral blood samples from individuals with allergic conditions . Specifically, EMR4P was identified among eight genes consistently overexpressed in all types of allergic multimorbidity (asthma, dermatitis, and rhinitis) in both pediatric and adult populations .

Interestingly, EMR4P shows differential regulation in different inflammatory contexts. While it is upregulated in allergic conditions, a meta-analysis of whole blood transcriptome datasets revealed that EMR4P expression was lower in respiratory syncytial virus (RSV)-infected groups compared to healthy controls . This contrasting regulation suggests context-specific functions in different immune settings.

The following table summarizes key findings regarding EMR4P expression in various conditions:

ConditionEMR4P ExpressionStudy PopulationReference
Allergic multimorbidity (asthma, dermatitis, rhinitis)Consistently overexpressedChildren and adolescents
RSV infectionReduced expression compared to healthy controlsChildren
Airway type 2 eosinophil inflammationInvolved/likely increasedVarious (citing Ditz et al., 2021)

What is currently known about EMR4P's molecular interactions and signaling pathways?

Based on its classification as an adhesion GPCR, EMR4P likely signals through G-protein dependent pathways typical of this receptor family, possibly including Gαs, Gαi/o, Gαq/11, or Gα12/13 coupling, though specific coupling preferences have not been definitively established in the available research data.

What experimental approaches are most effective for studying EMR4P expression and function?

Researchers investigating EMR4P have employed multiple complementary approaches to characterize its expression and potential functions. Based on published methodologies, the following experimental strategies are recommended:

For expression analysis:

  • Transcriptomic profiling: High-throughput approaches using microarrays or RNA sequencing have successfully identified EMR4P as differentially expressed in various conditions . The MeDALL study utilized Affymetrix Human Transcriptome Array 2.0 (HTA) for initial discovery and verification .

  • RT-qPCR validation: For targeted validation of EMR4P expression, researchers have employed RT-qPCR using platforms such as the LightCycler 480 II (Roche) with QuantiFAST SyBR kit (Qiagen) . This provides a cost-effective approach for validating expression in larger sample sets.

  • RNA-Seq approach: For comprehensive transcriptome analysis, the TruSeq Stranded Total RNA Library Prep Kit with Ribo-Zero Gold High Throughput kit has been used, with libraries run on the NextSeq 500 using NextSeq® 500/550 High Output Kit v2, paired-end reads at 75 cycles, and 80 million reads per sample .

For functional analysis:

  • Cell adhesion assays: Given EMR4P's role in leukocyte adhesion, functional assays measuring adhesion properties (with and without EMR4P manipulation) would be valuable, though specific protocols for EMR4P are not detailed in the available research data.

  • Genetic manipulation: While not explicitly described for EMR4P in the search results, standard approaches including overexpression, knockdown/knockout (using siRNA, shRNA, or CRISPR-Cas9), and rescue experiments would be appropriate for examining functional consequences of EMR4P modulation.

How should researchers design studies to investigate EMR4P's role in allergic multimorbidity?

Investigating EMR4P's role in allergic multimorbidity requires careful study design that accounts for the complexity of allergic phenotypes and potential confounding factors. Based on successful approaches documented in the literature, researchers should consider:

  • Cohort selection and phenotyping: Include participants with well-characterized allergic conditions (asthma, dermatitis, rhinitis) both in isolation and in multimorbid combinations. The MeDALL study demonstrated that EMR4P expression patterns differ between single allergic conditions and multimorbid states . Careful phenotyping using standardized definitions is essential, as demonstrated in the MeDALL study where "definition of current asthma, dermatitis or rhinitis was agreed by a panel of experts" .

  • Sample collection considerations: Since EMR4P expression has been primarily studied in whole blood, standardized blood collection protocols are critical. Researchers should account for factors that might influence immune cell gene expression, including time of day, recent allergen exposure, and medication use (particularly corticosteroids, which can significantly modulate gene expression).

  • Statistical approaches: Implement robust statistical methods that account for potential confounders. The MeDALL study used "multivariable models adjusted for covariables (sex, cohort, batch, age)" and employed surrogate variable analysis to "capture cell blood heterogeneity" . For RNA-seq data, appropriate tools include DESeq2, with Benjamini-Hochberg false discovery rate correction for multiple testing .

  • Integration with clinical data: Correlate EMR4P expression with clinical parameters such as disease severity, biomarkers of type 2 inflammation (e.g., eosinophil counts, FeNO), and treatment response. This approach aligns with recent trends in asthma biomarker research where "the combination of biomarkers with relevant clinical characteristics may be more accurate in the characterization of asthma phenotypes" .

What are the current challenges in identifying EMR4P's endogenous ligand(s)?

The identification of EMR4P's endogenous ligand(s) represents a significant research challenge, as reflected by its continued classification as an orphan receptor . Several factors contribute to this challenge:

  • Technical limitations in orphan receptor deorphanization: Traditional ligand screening approaches may not be optimal for adhesion GPCRs like EMR4P, which often have complex activation mechanisms potentially involving both tethered agonism and external ligands. The IUPHAR committee notes that "considerable progress has been made in screening artificially expressed receptors to identify the cognate endogenous ligand," but EMR4P remains among those without identified ligands .

  • Validation criteria: The IUPHAR requires stringent validation for receptor-ligand pairings, including "two or more refereed papers from independent research groups" demonstrating activity "with a potency that is consistent with a physiologic function" . For EMR4P, reported pairings may not yet meet these criteria or may remain controversial.

  • Potential for non-conventional ligands: As an adhesion GPCR, EMR4P may interact with extracellular matrix components, membrane-bound proteins on other cells, or other non-conventional ligands that are difficult to identify using standard soluble ligand screening approaches.

  • Species differences: The search results indicate that some related receptors are absent in mice , suggesting potential challenges in using standard animal models for validating ligand candidates in vivo, which complicates the deorphanization process.

What bioinformatic approaches are most effective for analyzing EMR4P-related datasets?

Researchers investigating EMR4P have employed several sophisticated bioinformatic approaches to analyze high-dimensional data and extract meaningful biological insights. Based on published methodologies, the following analytical strategies are recommended:

  • Differential expression analysis: For identifying EMR4P expression changes between conditions, tools like limma (for microarray data) and DESeq2 (for RNA-seq data) have been successfully applied . These analyses should incorporate appropriate adjustments for covariates (age, sex, batch effects) and multiple testing correction using the Benjamini-Hochberg procedure.

  • Co-expression network analysis: Weighted Gene Co-expression Network Analysis (WGCNA) has been used to identify modules of co-expressed genes that include EMR4P, providing insights into its functional associations . This approach is based on the principle that "genes within the same modules are likely to behave similarly and process within the same biological processes" .

  • Protein-protein interaction network (PPIN) analysis: This approach has been used to map the functional relationships between EMR4P and other proteins in allergic disease contexts . PPIN analysis can reveal key signaling pathways and potential mechanistic links that might not be apparent from expression data alone.

  • Pathway and functional enrichment analysis: Tools like g:Profiler for analyzing gene ontology and pathway (KEGG, REACTOME) enrichment, along with disease ontology (DOSE), have been applied to contextualize EMR4P function . Visualization tools like REVIGO for treemap representation can help interpret these results.

  • Synergy assessment: To evaluate the non-linear effects of disease multimorbidity on EMR4P expression, researchers have computed "the coefficient of linearity σ based on the difference in normalized FC between 1 and 2 diseases, and 2 and 3 diseases" . This approach can reveal whether EMR4P responds synergistically to the presence of multiple allergic conditions.

How can researchers effectively generate and validate recombinant EMR4P for functional studies?

While the search results don't provide specific protocols for generating recombinant EMR4P, the following methodological considerations would be applicable based on standard approaches for GPCR research:

  • Expression system selection: For recombinant EMR4P production, mammalian expression systems (e.g., HEK293, CHO cells) are likely most appropriate to ensure proper folding and post-translational modifications. Insect cell (Sf9, Sf21) systems using baculovirus vectors represent an alternative that often yields higher protein amounts.

  • Construct design considerations:

    • Include epitope tags (e.g., FLAG, HA, His) for detection and purification

    • Consider incorporating fluorescent protein fusions (e.g., GFP) for localization studies

    • For adhesion GPCRs like EMR4P, construct design should account for the potential autoproteolytic processing at the GPS (GPCR proteolysis site) domain

    • Include appropriate signal sequences to ensure proper membrane targeting

  • Validation approaches:

    • Western blotting with domain-specific antibodies to confirm expression and processing

    • Surface biotinylation to verify membrane localization

    • Glycosylation analysis to confirm proper post-translational processing

    • Functional assays to assess signaling capacity (e.g., cAMP, Ca²⁺ mobilization, β-arrestin recruitment)

  • Quality control: Ensure batch-to-batch consistency through standardized characterization of recombinant protein, including purity assessment, activity testing, and stability analysis.

While many GPCRs have been successfully produced as recombinant proteins for structural and functional studies, the adhesion GPCR subfamily presents unique challenges due to their large extracellular domains and complex activation mechanisms that should be considered in experimental design.

What are the optimal cell and animal models for investigating EMR4P function in allergic diseases?

Based on EMR4P's expression patterns and functional associations, several experimental models would be appropriate for investigating its role in allergic diseases:

Cell models:

  • Primary human leukocytes: Given EMR4P's association with leukocyte adhesion and allergic diseases, primary human immune cells represent physiologically relevant models . Particularly valuable would be:

    • Eosinophils (given EMR4P's association with eosinophil-related pathways in allergic diseases)

    • T cells (particularly Th2 cells involved in allergic responses)

    • Mast cells and basophils

    • Peripheral blood mononuclear cells (PBMCs)

  • Cell lines: Human immune cell lines with manipulated EMR4P expression could provide consistent systems for mechanistic studies. Potential options include:

    • THP-1 (monocytic leukemia line)

    • Jurkat (T cell leukemia line)

    • MOLT-4 (acute lymphoblastic leukemia line)

    • U937 (histiocytic lymphoma line)

Animal models:

The search results indicate that some related receptors are absent in mice , suggesting potential challenges in identifying appropriate animal models. Researchers should consider:

  • Verification of orthologs: Confirm whether functional EMR4P orthologs exist in potential model organisms before proceeding with in vivo studies.

  • Humanized models: If murine orthologs are absent or significantly different, consider humanized mouse models with engrafted human immune cells or transgenic expression of human EMR4P.

  • Disease-specific models: For allergic disease studies, models that recapitulate key features of human allergic conditions would be most relevant:

    • Allergic asthma models (e.g., house dust mite or ovalbumin sensitization and challenge)

    • Atopic dermatitis models (e.g., MC903/calcipotriol-induced or barrier disruption models)

    • Allergic rhinitis models

These models should ideally incorporate readouts relevant to EMR4P's proposed functions, such as immune cell migration, adhesion, and type 2 inflammatory responses.

How might EMR4P contribute to the development of precision medicine approaches for allergic diseases?

EMR4P shows significant potential for advancing precision medicine in allergic diseases through several mechanisms:

  • Biomarker development: The consistent overexpression of EMR4P across allergic multimorbidity suggests its potential as a blood-based biomarker . Given the current clinical focus on combining biomarkers for improved predictive value, EMR4P could be integrated into multicomponent algorithms for allergic disease phenotyping. As noted in recent research, "the combination of different biomarkers may add additional discriminatory value in predicting exacerbations and response to treatment" .

  • Endotype identification: EMR4P's association with type 2 inflammatory pathways positions it as a potential marker for identifying patients with predominant type 2 endotypes who might respond to targeted biologics. The association of EMR4P with IL5/JAK/STAT and IL33/ST2/IRAK/TRAF pathways aligns with mechanisms targeted by existing biologics for severe asthma.

  • Novel therapeutic target development: As understanding of EMR4P's functional role advances, it could itself emerge as a therapeutic target. Given its consistent overexpression across allergic conditions and association with leukocyte adhesion , EMR4P-targeting approaches might address multiple allergic manifestations simultaneously.

  • Predictive modeling: Integration of EMR4P expression data with clinical parameters could contribute to improved predictive models for disease progression or treatment response. This aligns with the trend described in recent research where "current asthma guidelines have now adapted algorithms for the initial choice of targeted biologic treatments and for the monitoring of subsequent treatment response" .

What emerging technologies could accelerate progress in EMR4P research?

Several cutting-edge technologies hold promise for advancing EMR4P research and overcoming current limitations:

  • Single-cell transcriptomics: This technology could provide higher-resolution insights into which specific immune cell populations express EMR4P and how its expression changes during cell activation and differentiation. Such analyses could clarify whether EMR4P expression is restricted to particular leukocyte subsets or activation states.

  • CRISPR-Cas9 genome editing: Advanced gene editing approaches could enable precise manipulation of EMR4P in relevant cell types to elucidate its functional role. This technology has revolutionized functional genomics, allowing for sophisticated experiments including:

    • Complete gene knockout

    • Introduction of specific mutations

    • Tagging of endogenous proteins

    • Conditional/inducible expression modulation

  • Advanced receptor deorphanization platforms: Novel high-throughput approaches for ligand identification, including those that account for the unique activation mechanisms of adhesion GPCRs, could help identify EMR4P's endogenous ligand(s). These might include:

    • Cell-based screening with diverse compound libraries

    • Proximity labeling approaches to identify interaction partners

    • Advanced computational prediction methods

  • Organ-on-chip and microphysiological systems: These technologies could provide more physiologically relevant contexts for studying EMR4P function in complex tissue environments. For allergic airway disease research, lung-on-chip models incorporating multiple cell types (epithelial cells, immune cells, etc.) could offer insights into EMR4P's role in cell-cell interactions during allergic responses.

  • Spatial transcriptomics: By preserving spatial information while analyzing gene expression, this technology could reveal how EMR4P-expressing cells are distributed within tissues in health and disease.

What are the critical knowledge gaps that must be addressed to advance EMR4P research?

Despite progress in identifying EMR4P's association with allergic diseases, several critical knowledge gaps require attention to fully understand its biology and therapeutic potential:

  • Ligand identification: The most fundamental gap remains the identification of EMR4P's endogenous ligand(s) . Without this information, understanding EMR4P's precise activation mechanisms and physiological roles remains challenging. Addressing this gap would potentially enable the development of pharmacological tools to modulate EMR4P function.

  • Signaling mechanisms: The specific G-protein coupling preferences and downstream signaling pathways activated by EMR4P remain poorly characterized. Understanding these signaling mechanisms is essential for interpreting EMR4P's cellular effects and identifying potential points for therapeutic intervention.

  • Functional consequences of overexpression: While EMR4P is consistently overexpressed in allergic multimorbidity , the functional consequences of this overexpression remain unclear. Does EMR4P actively contribute to disease pathogenesis, or is its upregulation merely a consequence of the inflammatory state? Functional studies in relevant model systems are needed to address this question.

  • Regulatory mechanisms: The mechanisms controlling EMR4P expression in different contexts (upregulated in allergic conditions but downregulated in RSV infection ) remain unexplored. Understanding these regulatory mechanisms could provide insights into how EMR4P expression is modulated in different immune contexts.

  • Cell type-specific functions: The specific cell types expressing EMR4P and its functions within these cells require further characterization. This information would clarify whether therapeutic targeting of EMR4P should focus on particular immune cell populations.

  • Genetic variation: The impact of genetic polymorphisms on EMR4P expression and function has not been systematically investigated. Such variations could contribute to differential susceptibility to allergic diseases or treatment responses.

Addressing these knowledge gaps would significantly enhance understanding of EMR4P biology and its potential applications in diagnosing and treating allergic diseases.

What are the most reliable antibodies and molecular tools for EMR4P research?

While the search results don't provide specific recommendations for EMR4P antibodies or molecular tools, researchers should consider the following general guidelines when selecting reagents for EMR4P studies:

  • Antibody selection criteria:

    • Validate specificity using positive and negative controls (e.g., cells with knockout or overexpression of EMR4P)

    • Select antibodies raised against conserved epitopes if working across species

    • Choose application-appropriate antibodies (Western blot, flow cytometry, immunohistochemistry, etc.)

    • Consider domain-specific antibodies to distinguish different regions of EMR4P (e.g., N-terminal vs. C-terminal)

  • Expression constructs:

    • Select expression vectors with appropriate promoters for the target cell type

    • Consider tagged constructs (epitope tags, fluorescent proteins) for detection and localization studies

    • For adhesion GPCRs like EMR4P, ensure constructs account for potential autoproteolytic processing

  • Gene modulation tools:

    • siRNA/shRNA: Design targeting conserved regions with minimal off-target effects

    • CRISPR-Cas9: Select guide RNAs with high on-target and low off-target scores

    • Overexpression: Consider inducible systems to control expression levels

  • Reporter assays:

    • For measuring EMR4P signaling, consider second messenger assays (cAMP, Ca²⁺) and β-arrestin recruitment assays

    • The GPCR Tango assay mentioned in search result may be adaptable for EMR4P studies

When selecting commercial reagents, researchers should prioritize those validated in peer-reviewed publications and consult resources like Antibodypedia or the Antibody Registry to assess reliability.

How can researchers effectively design and optimize RNA-seq experiments to study EMR4P expression in different contexts?

Designing effective RNA-seq experiments for EMR4P research requires careful consideration of several factors to ensure robust and reproducible results:

  • Experimental design considerations:

    • Include appropriate biological replicates (minimum n=3, preferably more for clinical samples)

    • Plan for adequate sequencing depth (>25 million paired-end reads per sample for whole transcriptome analysis)

    • Include technical controls to assess technical variability

    • Incorporate appropriate disease and healthy controls

  • Sample collection and processing:

    • Standardize collection protocols to minimize preanalytical variables

    • For blood samples, consider using RNA preservation tubes (e.g., PAXgene, Tempus)

    • Assess RNA integrity (RNA Integrity Number > 6 recommended)

    • Document relevant clinical information and potential confounding factors

  • Library preparation and sequencing:
    Based on successfully applied methods in EMR4P-related research, consider:

    • TruSeq Stranded Total RNA Library Prep Kit with Ribo-Zero Gold for ribosomal RNA depletion

    • Paired-end sequencing at 75-100 cycles

    • Target 80 million reads per sample for whole transcriptome analysis

  • Data analysis pipeline:
    The following analysis steps have been successfully applied in EMR4P-related research:

    • Quality control using FastQC

    • Trimming of low-quality reads and adapters using Trim Galore! and Cutadapt

    • Alignment to reference genome using STAR

    • Quantification of uniquely mapped reads using RSEM

    • Differential expression analysis using DESeq2

    • Multiple testing correction using Benjamini-Hochberg procedure

  • Validation strategies:

    • Confirm key findings with RT-qPCR on an independent sample set

    • Consider targeted validation of EMR4P expression in specific cell populations

    • Correlate expression data with protein-level measurements when possible

Following these guidelines will help ensure that RNA-seq experiments provide robust insights into EMR4P expression patterns across different biological contexts.

What collaborative research networks or resources are available for advancing EMR4P research?

While the search results don't specifically mention collaborative networks focused on EMR4P, researchers interested in this topic could benefit from engaging with the following types of research communities and resources:

  • GPCR research consortia and databases:

    • International Union of Basic and Clinical Pharmacology (IUPHAR) and the IUPHAR Database

    • GPCR Network (GPCR-net)

    • NIMH Psychoactive Drug Screening Program (PDSP)

    • GPCR-focused structural biology consortia

  • Allergy and immunology research networks:

    • MeDALL (Mechanisms of the Development of Allergy) consortium, which has conducted significant research on EMR4P in allergic multimorbidity

    • ISAR (International Severe Asthma Registry) study group

    • SARP (Severe Asthma Research Program)

    • PRECISE (PRECISion medicine in severe Eosinophilic asthma) network

  • Biobanks and cohort resources:

    • Cohorts with extensive phenotyping and biospecimens from allergic disease patients, such as BAMSE, GINIplus, INMA, and EVA-PR mentioned in the search results

    • UK Biobank and other large population biobanks with genomic and phenotypic data

    • Specialized biobanks focused on allergic diseases and respiratory conditions

  • Functional genomics and transcriptomics resources:

    • Gene Expression Omnibus (GEO) for accessing published transcriptomic datasets

    • Genomics of Gene Regulation project resources

    • Single Cell Expression Atlas

    • Human Cell Atlas project data

  • Computational and bioinformatic resources:

    • Protein-protein interaction databases like BioGRID referenced in the EMR4P research

    • Pathway databases including REACTOME and KEGG

    • Gene ontology and functional enrichment tools like g:Profiler

    • WGCNA (Weighted Gene Co-expression Network Analysis) resources

Engaging with these networks and resources could provide EMR4P researchers with access to valuable samples, data, methodologies, and collaborative opportunities to accelerate progress in understanding this intriguing receptor and its potential applications in allergic disease management.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.