Recombinant Human Putative FXYD domain-containing ion transport regulator 8 (FXYD6P3)

Shipped with Ice Packs
In Stock

Description

Expression System

  • Host: Escherichia coli

  • Vector: Optimized ORF clones for high-yield expression

Purification Protocol

  1. Lysis: Cells are lysed under denaturing or native conditions.

  2. Affinity Chromatography: His tag binds to nickel or cobalt resins .

  3. Buffer Exchange: Formulated in Tris buffer (pH 8.0) with NaCl, glycerol, and Sarkosyl .

Key Findings from Analogous Studies:

  • Displacement of native FXYD proteins by recombinant analogs alters ATPase stability and cellular responses to stressors like doxorubicin .

  • A Cys-to-Ser mutation in FXYD3 abolished protective effects against β1 subunit glutathionylation, highlighting the importance of conserved residues .

Research Applications

ApplicationUse Case
Antibody ProductionNative antigen for generating custom antibodies
Protein-Protein Interaction StudiesCo-immunoprecipitation with Na+/K+-ATPase subunits
Functional AssaysScreening for ion transport modulators
Diagnostic StandardsPositive controls in ELISA

Challenges and Limitations

  • Partial Protein Length: Some constructs exclude transmembrane or regulatory domains .

  • Species Specificity: Studies limited to human-derived systems; cross-reactivity with other species unverified .

  • Functional Redundancy: Overlap with FXYD8 complicates isoform-specific analyses .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary based on purchase method and location. Please consult your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, serving as a reference point.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and protein stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses and avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
FXYD6P3; FXYD8; Putative FXYD domain-containing ion transport regulator 8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-94
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
FXYD6P3
Target Protein Sequence
SAAKEKEIDPFHYNYQTLRIGGLVFDVVLFLVPSCHLLSHRCKCSFNQKPQDPGDKEAQVENFITANAKEPQKAKN
Uniprot No.

Target Background

Database Links

HGNC: 31124

Protein Families
FXYD family
Subcellular Location
Membrane; Single-pass type I membrane protein.

Q&A

What is the structural relationship between FXYD6P3 and other members of the FXYD family?

FXYD6P3, as a putative member of the FXYD family, likely shares the characteristic 35-amino acid signature sequence domain that begins with the PFXYD motif. This domain contains 7 invariant and 6 highly conserved amino acids that are crucial for protein function. While the canonical FXYD family in mammals contains seven established members (FXYD1-7), FXYD6P3 represents a potential additional member with structural homology to FXYD6 (phosphohippolin) . When investigating FXYD6P3, researchers should perform comparative sequence analyses with other FXYD proteins, particularly focusing on the conservation of the signature FXYD domain and transmembrane regions.

What is the presumed functional role of FXYD6P3 in ion transport regulation?

Based on the established functions of other FXYD family members, FXYD6P3 likely acts as a modulator of Na+, K+-ATPase activity. The FXYD family performs fine-tuning of ion transport through association with Na+, K+-ATPase molecules, adjusting their pump activity and modifying ion channel function . FXYD proteins are predominantly expressed in specific tissues to precisely regulate physiological ion balance. To investigate FXYD6P3's specific modulatory effects, researchers should conduct Na+, K+-ATPase activity assays in the presence and absence of the recombinant protein under various physiological conditions to quantify its impact on pump kinetics.

How does FXYD6P3 potentially differ from FXYD6 in terms of function and expression?

While FXYD6P3 is putatively related to FXYD6 (phosphohippolin), researchers should investigate potential functional divergence. FXYD6 is primarily expressed in the brain and associated with neuronal excitability . To establish FXYD6P3's distinct identity, conduct comparative expression profiling across tissues using qPCR and western blotting. Additionally, perform co-immunoprecipitation studies to determine if FXYD6P3 associates with the same or different α-subunit isoforms of Na+, K+-ATPase compared to FXYD6. Electrophysiological studies in Xenopus oocytes expressing FXYD6 versus FXYD6P3 would also reveal functional differences in their modulation of Na+, K+-ATPase activity.

What are the optimal expression systems for producing recombinant FXYD6P3 protein?

For successful expression of recombinant FXYD6P3, researchers should consider multiple expression systems, each with specific advantages:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effectiveMay require refolding due to inclusion bodies
Mammalian cellsNative-like post-translational modificationsLower yield, higher cost
Insect cellsGood compromise between yield and modificationsModerate complexity
Cell-free systemsAvoids toxicity issuesLimited scale

For membrane proteins like FXYD6P3, specialized strategies such as detergent micelles, proteoliposomes, nanodiscs, or polymer-based systems should be employed to maintain proper folding and function . To verify protein quality, combine size exclusion chromatography with circular dichroism spectroscopy to assess both purity and secondary structure integrity.

How can researchers effectively study FXYD6P3 interactions with Na+, K+-ATPase?

To investigate FXYD6P3 interactions with Na+, K+-ATPase, implement a multi-technique approach:

  • Co-immunoprecipitation assays to determine physical association with Na+, K+-ATPase α subunit

  • Surface plasmon resonance to measure binding kinetics and affinity

  • Patch-clamp electrophysiology in systems co-expressing FXYD6P3 and Na+, K+-ATPase

  • Fluorescence resonance energy transfer (FRET) using labeled proteins to detect interactions in live cells

Based on methodology with other FXYD proteins, include recombinant FXYD6P3 in patch pipette solutions during voltage clamp experiments to assess direct effects on Na+, K+-ATPase pump currents (Ip) . Additionally, competitive displacement assays similar to those performed with FXYD3 can determine whether FXYD6P3 competes with other FXYD proteins for binding to the pump complex .

What approaches are most effective for detecting FXYD6P3 glutathionylation and its impact on function?

To investigate potential glutathionylation of FXYD6P3, researchers should:

  • Utilize biotin-GSH loading followed by streptavidin precipitation to detect glutathionylation, similar to methods used for other FXYD proteins

  • Employ GSH antibody immunoblotting as a complementary detection method

  • Perform site-directed mutagenesis of conserved cysteine residues to identify specific sites of glutathionylation

  • Assess the functional impact by measuring Na+, K+-ATPase activity in the presence of wild-type versus cysteine-mutant FXYD6P3 under oxidative conditions

Based on findings with other FXYD proteins, researchers should investigate whether FXYD6P3 can reverse β1 subunit glutathionylation and subsequent pump inhibition, potentially serving as an antioxidant mechanism . Exposure to oxidants like peroxynitrite (ONOO-) or angiotensin II can be used to induce oxidative conditions while measuring changes in pump function.

What is the tissue-specific expression pattern of FXYD6P3 and how does it compare to other FXYD family members?

To characterize FXYD6P3 tissue distribution, comprehensive expression profiling should be performed using:

  • RT-qPCR across multiple human tissues and cell types

  • Western blotting with specific antibodies against FXYD6P3

  • Immunohistochemistry in tissue sections to determine cellular localization

  • Single-cell RNA sequencing to identify specific cell populations expressing FXYD6P3

Compare results with known expression patterns of established FXYD members: FXYD1 (heart), FXYD2 (kidney), FXYD3 (multiple tissues), FXYD4 (kidney), FXYD5 (multiple tissues, especially epithelia), FXYD6 (brain), and FXYD7 (brain) . An important methodological consideration is ensuring antibody specificity, as FXYD6P3 may share epitopes with FXYD6. Validation using knockout/knockdown controls or recombinant proteins as standards is essential.

How is FXYD6P3 expression regulated under different physiological and pathological conditions?

To investigate FXYD6P3 expression regulation:

  • Analyze promoter regions for transcription factor binding sites using bioinformatic approaches

  • Perform reporter gene assays to identify critical regulatory elements

  • Examine expression changes under conditions known to affect ion homeostasis (hypoxia, oxidative stress, altered ion concentrations)

  • Compare expression in normal versus disease tissues (particularly cancers and disorders of ion homeostasis)

Since other FXYD proteins show altered expression in cancer, researchers should systematically examine FXYD6P3 expression across cancer tissues using tissue microarrays or mining public cancer genomics databases. Additionally, investigate potential epigenetic regulation through methylation analysis of the FXYD6P3, as this may contribute to tissue-specific expression patterns.

How does FXYD6P3 potentially contribute to redox regulation of Na+, K+-ATPase?

Based on the established role of other FXYD proteins in redox regulation, investigate whether FXYD6P3 participates in similar mechanisms:

  • Assess whether FXYD6P3 contains reactive cysteine residues susceptible to glutathionylation similar to those identified in other FXYD proteins

  • Determine if FXYD6P3 can reverse β1 subunit glutathionylation, potentially protecting Na+, K+-ATPase from oxidative inhibition

  • Examine whether the reactivity of cysteines in FXYD6P3 depends on flanking basic amino acids, as observed with other FXYD proteins

  • Measure Na+, K+-ATPase pump currents in the presence of FXYD6P3 under oxidative conditions

Research methodology should include two-electrode voltage clamp techniques in Xenopus oocytes expressing Na+, K+-ATPase with or without FXYD6P3, exposing them to oxidative signals such as peroxynitrite or paraquat . Create cysteine-free FXYD6P3 mutants to determine if protective effects against oxidative inhibition are cysteine-dependent.

What is the relationship between FXYD6P3 and intracellular signaling pathways?

To investigate FXYD6P3 integration with signaling networks:

  • Determine if FXYD6P3 is a substrate for protein kinases (PKA, PKC) as observed with FXYD1

  • Identify potential phosphorylation sites through mass spectrometry analysis of recombinant FXYD6P3 following in vitro kinase reactions

  • Examine FXYD6P3's response to angiotensin II signaling, which has been shown to affect other FXYD proteins through oxidative mechanisms

  • Investigate interactions with glutathionylation/deglutathionylation systems

Researchers should employ phosphoproteomic approaches to identify post-translational modifications of FXYD6P3 in response to various stimuli. Additionally, examine whether FXYD6P3 interacts with proteins involved in redox homeostasis using proximity labeling techniques such as BioID or APEX.

What is the potential role of FXYD6P3 in cancer progression and metastasis?

Given that other FXYD family members have been implicated in various cancers , investigate FXYD6P3's potential oncogenic or tumor-suppressive roles:

  • Analyze FXYD6P3 expression in cancer tissues compared to matched normal tissues across multiple cancer types

  • Perform gain-of-function and loss-of-function studies in cancer cell lines to assess effects on proliferation, migration, and invasion

  • Examine correlations between FXYD6P3 expression levels and patient outcomes using cancer genomics databases

  • Investigate mechanisms by which FXYD6P3 might influence cancer cell phenotypes, focusing on ion homeostasis alterations

The methodological approach should include stable cell line development with modulated FXYD6P3 expression, followed by comprehensive phenotypic characterization and signaling pathway analysis. Additionally, xenograft models would provide in vivo validation of findings from cell culture experiments.

How might FXYD6P3 function be targeted for therapeutic intervention in ion transport disorders?

To explore therapeutic potential:

  • Develop screening assays for small molecules that modulate FXYD6P3-Na+, K+-ATPase interactions

  • Design peptide mimetics based on the FXYD domain that could compete with FXYD6P3 binding

  • Investigate whether FXYD6P3's potential antioxidant properties could be exploited in conditions characterized by oxidative stress

  • Examine gene therapy approaches for conditions where FXYD6P3 dysfunction contributes to pathology

A key methodological consideration is developing high-throughput screening platforms that can detect subtle changes in Na+, K+-ATPase activity. Fluorescence-based assays measuring ion fluxes or membrane potential changes in cell lines expressing FXYD6P3 and Na+, K+-ATPase would be valuable for compound screening.

How does the three-dimensional structure of FXYD6P3 influence its interaction with Na+, K+-ATPase?

To elucidate structural determinants of FXYD6P3 function:

  • Perform structural studies using X-ray crystallography or cryo-electron microscopy of FXYD6P3 in complex with Na+, K+-ATPase

  • Use NMR spectroscopy to characterize the solution structure of FXYD6P3 and identify dynamic regions

  • Apply molecular dynamics simulations to model FXYD6P3-Na+, K+-ATPase interactions and predict effects of mutations

  • Design structure-based mutations to test key interaction interfaces

Reference the published three-dimensional structures of other FXYD proteins in complex with Na+, K+-ATPase to guide structural studies of FXYD6P3. A methodological challenge is obtaining sufficient quantities of properly folded membrane protein complexes for structural studies, which may require optimization of detergents or nanodiscs for stabilization.

How does FXYD6P3 interact with other members of the FXYD family in regulating Na+, K+-ATPase?

To investigate potential cooperative or competitive interactions:

  • Perform co-expression studies of FXYD6P3 with other FXYD proteins to detect functional interactions

  • Use competitive binding assays to determine if FXYD6P3 can displace other FXYD proteins from Na+, K+-ATPase complexes

  • Employ proximity labeling techniques to identify the protein interaction network of FXYD6P3 in native tissues

  • Develop mathematical models of Na+, K+-ATPase regulation incorporating multiple FXYD proteins

Methodologically, this requires careful design of experiments that can distinguish between direct and indirect effects. Techniques such as bioluminescence resonance energy transfer (BRET) between differentially tagged FXYD proteins could reveal whether they form heteromeric complexes or compete for the same binding sites on Na+, K+-ATPase.

What role might FXYD6P3 play in ion transport microviscosity and the diffusion of ion transport regulators?

Building on ion transport diffusion coefficient research , investigate how FXYD6P3 affects:

  • Diffusion coefficients of cations and anions in the membrane microenvironment

  • Microviscosity parameters (η, α, and β) that influence ion and molecule mobility

  • Path structure in solid media for ion transport

  • Solvation effects on lithium and other ions in the presence of FXYD6P3

Methodologically, employ nuclear magnetic resonance (NMR) techniques to measure diffusion coefficients (D) of various ionic species in membrane systems with and without FXYD6P3 . Calculate inherent diffusion coefficients of cations (Dcation) and anions (Danion) using the Nernst-Einstein equation relating conductivity to diffusion coefficients . This advanced research direction could reveal how FXYD proteins modulate not just pump activity but the entire ion transport microenvironment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.