Recombinant Human Putative germ cell-specific gene 1-like protein 2

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GSG1L2; Germ cell-specific gene 1-like protein 2; GSG1-like protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-235
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
GSG1L2
Target Protein Sequence
SHWCEGTRRVVKPLCQDQPGGQHCIHFKRDNSSNGRMDNNSQAVLYIWELGDDKFIQRGF HVGLWQSCEESLNGEDEKCRSFRSVVPAEEQGVLWLSIGGEVLDIVLILTSAILLGSRVS CRSPGFHWLRVDALVAIFMVLAGLLGMVAHMMYTTIFQITVNLGPEDWKPQTWDYGWSYC LAWGSFALCLAVSVSAMSRFTAARLEF
Uniprot No.

Target Background

Gene References Into Functions
  1. Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) PMID: 20379614
Database Links

HGNC: 51826

KEGG: hsa:644070

STRING: 9606.ENSP00000465978

Protein Families
GSG1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is known about GSG1L2 expression patterns in human tissues?

While direct expression data for GSG1L2 is limited in the provided search results, its classification as a germ cell-specific gene suggests expression primarily in reproductive tissues. Drawing parallels with other germ cell-specific proteins like PUM2, GSG1L2 likely shows highest expression in:

  • Embryonic stem cells

  • Developing and mature germ cells

  • Fetal and adult testis

  • Fetal and adult ovary

Similar to PUM2, GSG1L2 may show minimal expression in non-reproductive tissues. PUM2, for comparison, shows high expression in ES cells, fetal and adult ovary, and fetal and adult testis, with little or no expression in other tissues .

How does GSG1L2 compare with other germ cell-specific proteins?

ProteinExpression PatternKnown FunctionsStructural MotifsChromosome Location
GSG1L2Likely restricted to germ cellsPutative role in germ cell developmentNot fully characterizedHuman chromosome
PUM2Male/female germ cells and ES cellsTranslational regulation, germ cell maintenancePUF repeat domainHuman chromosome 2
DAZLMale/female germ cellsRNA binding, germ cell developmentRRM, DAZ repeatHuman chromosome 3
C2EIPPrimordial germ cellsRegulates differentiation via HH pathwayCytoplasmic proteinNot specified

These germ cell-specific proteins share common themes of involvement in germ cell development and maintenance, though through different molecular mechanisms .

What are the optimal storage and reconstitution conditions for recombinant GSG1L2?

For optimal results when working with recombinant GSG1L2:

Storage conditions:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • Aliquot reconstituted protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • Long-term storage requires -20°C/-80°C

Reconstitution protocol:

  • Briefly centrifuge vial before opening to bring contents to bottom

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration (recommended 50%)

  • Aliquot for long-term storage at -20°C/-80°C

Repeated freeze-thaw cycles significantly reduce protein activity and should be avoided through proper aliquoting .

What expression systems are most effective for producing functional GSG1L2?

E. coli has been successfully used as an expression system for recombinant GSG1L2. The protein is expressed with an N-terminal His tag to facilitate purification. The specific E. coli strain optimization parameters include:

  • Codon optimization for E. coli expression

  • Induction conditions (likely IPTG concentration, temperature, and duration)

  • Lysis and purification under conditions that maintain protein folding

  • Quality control to ensure >90% purity via SDS-PAGE

Alternative expression systems like mammalian or insect cells might be considered for studies requiring post-translational modifications, though no data on such systems is provided in the search results .

What methods are recommended for detecting GSG1L2 in experimental samples?

Based on methodologies used for similar germ cell-specific proteins:

Protein detection:

  • Western blotting using anti-GSG1L2 antibodies (recommended dilution 1:700)

  • Immunohistochemistry on tissue sections (recommended dilution 1:200)

  • Immunofluorescence for cellular localization studies

RNA detection:

  • Northern blotting for tissue expression patterns

  • RT-PCR using gene-specific primers

  • In situ hybridization for spatial expression in tissues

For RT-PCR analysis, design primers specific to GSG1L2 that span exon-exon junctions to avoid genomic DNA amplification. When performing immunohistochemistry, use appropriate controls including preimmune sera and peptide competition assays to validate antibody specificity .

How can researchers investigate the potential role of GSG1L2 in primordial germ cell development?

To investigate GSG1L2's role in primordial germ cell (PGC) development, researchers can employ multiple complementary approaches:

In vitro approaches:

  • PGC differentiation models: Differentiate embryonic stem cells toward PGCs with and without GSG1L2 knockdown/overexpression

  • Expression analysis: Track GSG1L2 expression during different stages of PGC development

  • Protein interaction studies: Identify protein binding partners using co-immunoprecipitation, yeast two-hybrid, or proximity labeling techniques

In vivo approaches:

  • Genetic models: Generate GSG1L2 knockout or conditional knockout mice

  • Phenotypic analysis: Assess PGC numbers, migration patterns, and differentiation capacity

  • Rescue experiments: Reintroduce GSG1L2 to knockout models to confirm specificity

Comparing with C2EIP studies as a methodological template, researchers could measure PGC generation efficiency following GSG1L2 manipulation. C2EIP knockout during embryonic development reduced PGC generation 1.5-fold, while its overexpression nearly doubled generation efficiency both in vitro and in vivo .

What signaling pathways might GSG1L2 interact with during germ cell development?

While direct evidence for GSG1L2's involvement in specific signaling pathways is limited in the search results, several potential pathways merit investigation based on known functions of other germ cell-specific proteins:

  • Hedgehog (HH) signaling pathway: C2EIP, another PGC marker, activates this pathway via interaction with PTCH2

  • Translational regulation pathways: PUM2 functions as a translational regulator in germ cells

  • Pluripotency maintenance pathways: C2EIP influences expression of pluripotency-associated genes like Oct4 and Sox2

Experimental approaches to investigate these pathways include:

  • Pathway reporter assays following GSG1L2 manipulation

  • Analysis of post-translational modifications in pathway components

  • RNA immunoprecipitation to identify potential RNA targets

  • Transcriptome analysis following GSG1L2 knockdown/overexpression

Researchers should focus on pathways known to regulate germ cell specification, maintenance, and differentiation .

What are the experimental approaches to identify GSG1L2 protein interaction partners?

To comprehensively identify GSG1L2 protein interaction partners:

In vitro approaches:

  • Yeast two-hybrid screening: Use GSG1L2 as bait to screen cDNA libraries from germ cells

  • Co-immunoprecipitation (Co-IP): Pull down GSG1L2 and identify associated proteins by mass spectrometry

  • GST pull-down assays: Use recombinant GSG1L2 to pull down binding partners from cell lysates

  • Proximity-dependent biotin identification (BioID): Fuse GSG1L2 with a biotin ligase to identify proximal proteins

In silico approaches:

  • Structural homology modeling: Predict interaction partners based on protein structure

  • Phylogenetic profiling: Identify proteins with similar evolutionary conservation patterns

  • Co-expression analysis: Identify genes with similar expression patterns across tissues

When studying PUM2, researchers narrowed down regions required for interaction by truncation analysis in yeast two-hybrid systems. They determined that DAZ protein interacts with the RNA-binding region of PUM2 containing eight PUF repeats. Similar domain mapping could be performed for GSG1L2 .

How might epigenetic mechanisms regulate GSG1L2 expression?

Based on regulatory mechanisms observed in other germ cell-specific genes, GSG1L2 expression may be regulated by multiple epigenetic mechanisms:

Histone modifications:

  • Activating marks (H3K4me3, H3K27ac) likely present at the GSG1L2 promoter in germ cells

  • Repressive marks (H3K27me3, H3K9me3) potentially present in somatic tissues

DNA methylation:

  • Promoter methylation status may correlate with expression levels

  • Tissue-specific methylation patterns could explain restricted expression

Chromatin accessibility:

  • ATAC-seq or DNase-seq could reveal open chromatin at the GSG1L2 locus in germ cells

  • Closed chromatin expected in non-expressing tissues

Regulatory mechanisms identified for C2EIP, including regulation by histone acetylation and promoter methylation, provide a valuable experimental template. The transcription factor STAT1 regulates C2EIP activation, suggesting similar transcription factor-mediated regulation might occur for GSG1L2 .

What experimental approaches can determine if GSG1L2 functions in translational regulation?

To investigate GSG1L2's potential role in translational regulation (similar to PUM2):

RNA binding analysis:

  • RNA immunoprecipitation (RIP): Identify RNAs bound to GSG1L2 in vivo

  • Electrophoretic mobility shift assay (EMSA): Test direct RNA binding in vitro

  • CLIP-seq (Cross-linking immunoprecipitation): Map RNA binding sites with nucleotide resolution

  • RNA binding motif identification: Identify sequence preferences using systematic evolution of ligands by exponential enrichment (SELEX)

Translational impact assessment:

PUM2 has been shown to interact with the NRE (Nanos Response Element) sequence for translational repression, with its RNA-binding domain being 80% identical to Drosophila Pumilio. Similar functional conservation might exist for GSG1L2 .

How can GSG1L2 be utilized in monitoring primordial germ cell differentiation from embryonic stem cells?

GSG1L2 could serve as a valuable marker for monitoring PGC differentiation from embryonic stem cells:

Development of monitoring tools:

  • Reporter systems: Create GSG1L2 promoter-driven fluorescent reporter constructs

  • Antibody-based detection: Develop flow cytometry panels including GSG1L2 antibodies

  • Live cell imaging: Generate GSG1L2-fluorescent protein fusion constructs for real-time tracking

Applications in differentiation protocols:

  • Optimization of differentiation conditions: Measure GSG1L2 expression to evaluate protocol efficiency

  • Purification of PGC populations: Use GSG1L2 expression for cell sorting

  • Quality control: Assess GSG1L2 levels as a marker of successful PGC generation

Validation approach:
Compare GSG1L2 expression with established PGC markers like C2EIP. In C2EIP studies, its expression served as a specific indicator of PGC generation and regulated embryonic stem cell differentiation through Hedgehog pathway activation .

What is the relationship between GSG1L2 and pluripotency factors in stem cell maintenance?

The relationship between GSG1L2 and pluripotency factors remains to be fully characterized, but can be investigated through:

Expression correlation analysis:

  • Temporal expression profiling: Track GSG1L2 expression alongside Oct4, Sox2, Nanog during differentiation

  • Single-cell RNA-seq: Identify co-expression patterns at single-cell resolution

  • Spatial expression analysis: Determine if GSG1L2 is co-expressed with pluripotency factors in specific cell populations

Functional interaction studies:

  • ChIP-seq analysis: Determine if pluripotency factors bind GSG1L2 regulatory regions

  • GSG1L2 knockdown/overexpression: Assess impact on pluripotency gene expression

  • Protein complex analysis: Investigate if GSG1L2 interacts with pluripotency factors directly

Drawing parallels with C2EIP, which regulates differentiation by influencing the expression of pluripotency-associated genes such as Oct4 and Sox2, GSG1L2 might have similar functions in the regulation of stemness and differentiation .

How might GSG1L2 function differ between male and female germ cell development?

To investigate potential sex-specific functions of GSG1L2:

Comparative expression analysis:

  • Sex-specific expression profiling: Compare GSG1L2 expression levels in male versus female germ cells at equivalent developmental stages

  • Temporal expression patterns: Determine if expression timing differs between sexes

  • Cellular localization: Assess if protein localization differs between male and female germ cells

Functional studies:

  • Sex-specific knockout models: Generate male and female GSG1L2 knockout models and compare phenotypes

  • Interaction partner analysis: Identify sex-specific protein interaction partners

  • Transcriptome analysis: Compare GSG1L2-dependent gene expression changes between sexes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.