Recombinant Human Putative gonadotropin-releasing hormone II receptor (GNRHR2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Putative Gonadotropin-Releasing Hormone II Receptor (GNRHR2)

The putative gonadotropin-releasing hormone II receptor (GNRHR2) is a G protein-coupled receptor (GPCR) hypothesized to mediate the effects of gonadotropin-releasing hormone II (GnRH2). While its functional role in humans remains contentious due to genetic coding challenges, evidence from non-mammalian species and cancer research suggests potential clinical relevance. This article synthesizes structural, functional, and therapeutic insights into GNRHR2, emphasizing findings from peer-reviewed studies and molecular biology databases.

Ligand Binding and Signaling

GNRHR2 exhibits higher affinity for GnRH2 than GnRH1, with binding affinity 24-fold greater than GnRHR1 . This selectivity contrasts with GnRHR1, which binds both GnRH1 and GnRH2 with moderate affinity .

Key Signaling Pathways

ReceptorPrimary PathwaySecondary Pathways
GnRHR2Gαq/11 → IP3 → PKC MAPK/ERK, JNK
GnRHR1Gαq/11 → IP3 → PKC AKT, ERK

Activation of GnRHR2 triggers distinct downstream effects compared to GnRHR1, including:

  • Internalization: Requires β-arrestin in non-human models .

  • Desensitization: Faster receptor turnover due to cytoplasmic tail phosphorylation .

Role in Cancer and Therapeutic Potential

Cancer TypeCell Lines TestedObserved EffectsReceptor Involvement
BreastMCF-7, T47D↓ EGF signaling, reversed tamoxifen resistance GnRHR1/GnRHR2
OvarianSK-OV-3, OVCAR-3↓ Proliferation via GnRHR2-specific pathways GnRHR2-dominant
EndometrialIshikawa, HEC-1A↓ Growth factor-induced proliferation GnRHR2
ProstatePC-3, DU145↓ Metastasis via MMP-2 inhibition GnRHR1/GnRHR2

Mechanisms of Action

  • Anti-Proliferative: GnRH2 agonists inhibit EGF receptor autophosphorylation and MAPK/ERK pathways .

  • Pro-Apoptotic: GnRH2 antagonists activate p38 MAPK/JNK → BAX-mediated apoptosis .

  • Anti-Metastatic: Downregulation of MMP-2 in prostate cancer models .

Challenges and Controversies

  1. Genetic Instability in Humans: The GNRHR2 gene’s frameshift mutation raises doubts about its functionality .

  2. Receptor Ambiguity: Conflicting evidence on whether GnRH2 acts via GnRHR1 or GnRHR2 in certain cancers (e.g., breast vs. ovarian) .

  3. Limited Recombinant Models: No commercial recombinant human GNRHR2 is widely available; studies rely on non-human homologs (e.g., porcine, marmoset) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GNRHR2; Putative gonadotropin-releasing hormone II receptor; GnRH II receptor; GnRH-II-R; Type II GnRH receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-292
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
GNRHR2
Target Protein Sequence
MSAGNGTPWDATWNITVQWLAVDIACRTLMFLKLMATYSAAFLPVVIGLDRQAAVLNPLGSRSGVRKLLGAAWGLSFLLAFPQLFLFHTVHCAGPVPFTQCVTKGSFKAQWQETTYNLFTFCCLFLLPLTAMAICYSRIVLSVSRPQTRKGSHAPAGEFALPRSFDNCPRVRLRALRLALLILLTFILCWTPYYLLGMWYWFSPTMLTEVPPSLSHILFLLGLLNAPLDPLLYGAFTLGCRRGHQELSIDSSKEGSGRMLQEEIHAFRQLEVQKTVTSRRAGETKGISITSI
Uniprot No.

Target Background

Function
Putative receptor for gonadotropin-releasing hormone II (GnRH II); its functionality is likely non-existent.
Database Links

HGNC: 16341

OMIM: 612875

STRING: 9606.ENSP00000354569

UniGene: Hs.356873

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in many tissues.

Q&A

What is GNRHR2 and how does it differ from GNRHR1?

GNRHR2 encodes the putative gonadotropin-releasing hormone II receptor protein in humans. Unlike GNRHR1, which primarily functions in the hypothalamic-pituitary-gonadal axis to regulate reproductive functions, GNRHR2 is more ubiquitously expressed throughout the body. The key structural difference is that GNRHR2 is a 7-transmembrane G protein-coupled receptor in non-hominoid primates and non-mammalian vertebrates, while in humans, coding errors in the gene (frameshift mutation and premature stop codon) potentially affect its expression as a full-length protein . Despite these apparent limitations, there is mounting evidence for functional GNRHR2 in humans, possibly through production of a 5-transmembrane variant .

What is the genomic organization of human GNRHR2?

Humans possess two distinct GNRHR2 genetic elements: a full-length GNRHR2 gene located on chromosome 1 and a truncated GNRHR2 pseudogene on chromosome 14. The full-length gene contains coding errors that theoretically prevent production of a complete 7-transmembrane receptor. Interestingly, the truncated pseudogene on chromosome 14 appears to be more transcriptionally active and widely expressed than the chromosome 1 version . This complex genomic organization has contributed to the ongoing debate about whether humans express functional GNRHR2 protein.

How does GnRH2 binding affinity compare between GNRHR1 and GNRHR2?

GnRH2 binds to its cognate receptor (GNRHR2) with significantly greater affinity than to GNRHR1, with research showing a 24-fold increase in binding affinity. This enhanced binding leads to substantially greater activity (up to 440-fold increase) compared to GNRHR1 . Conversely, GnRH1 exhibits approximately 12-fold greater activity at GNRHR1 compared to GnRH2. These differential binding affinities are critical for understanding the specific physiological responses that may be mediated by each receptor type, particularly in tissues where both receptors might be expressed.

What techniques are most effective for detecting GNRHR2 expression in human tissues?

Multiple complementary approaches are recommended for reliable detection of GNRHR2 expression:

  • RT-PCR and qPCR: These methods can detect GNRHR2 mRNA, but primer design is crucial to distinguish between the full-length gene and pseudogene. Researchers should design primers that can differentiate between alternative splice variants.

  • Immunohistochemistry and Western blotting: For protein detection, validated antibodies specific to GNRHR2 are essential. Some researchers have successfully used antibodies that can detect the predicted 5-TM GnRHR2 (43-kDa) protein in various cancer cell lines .

  • Radioligand binding assays: Using radiolabeled GnRH2 with competition experiments involving GnRH1 analogues (like triptorelin) and pan-GnRHR antagonists (like cetrorelix) can help differentiate between GNRHR1 and GNRHR2 binding sites .

  • Functional assays: Measuring downstream signaling events after GnRH2 stimulation, combined with GNRHR1 knockdown, can help identify GNRHR2-specific responses.

How can researchers distinguish between GNRHR1 and GNRHR2 expression and activity in experimental settings?

Distinguishing between these receptors requires a multi-faceted approach:

  • Selective ligands: Utilize the differential binding affinities of GnRH1 and GnRH2 to their respective receptors. Triptorelin is highly specific for GNRHR1, while cetrorelix binds both receptors reasonably well .

  • Gene silencing: Implement GNRHR1 knockout or knockdown studies to isolate GNRHR2-mediated effects. If GnRH2 effects persist after GNRHR1 silencing, this suggests functional GNRHR2 activity .

  • Signaling pathway analysis: While both receptors utilize Gαq/11 to trigger IP3 synthesis and activate protein kinase C (PKC), downstream signaling pathways diverge. These differences can be exploited to differentiate receptor activation .

  • Binding competition studies: In photo-labeling or radioligand binding studies, GnRH2 more potently competes for GNRHR2 binding sites compared to GnRH1 analogues .

What evidence supports the existence of a functional GNRHR2 protein in humans despite genetic coding errors?

Despite the presence of a frameshift mutation and premature stop codon in the human GNRHR2 gene, several lines of evidence support the existence of a functional receptor:

  • Detection of a 5-TM variant: Immunoblotting and photo-labeling studies have identified a 43-kDa protein in various human cancer cell lines that corresponds to the predicted size of a 5-TM GNRHR2 receptor .

  • Selective binding properties: Radiolabeled GnRH2 binding studies show distinct binding patterns that can be displaced by GnRH2 and cetrorelix (pan GnRHR antagonist) but not by triptorelin (GnRH1 agonist), suggesting the presence of GNRHR2-specific binding sites .

  • Persistence of GnRH2 effects after GNRHR1 silencing: Anti-proliferative effects of GnRH2 persist in various cancer cell lines even after GNRHR1 knockdown, indicating functional GNRHR2-mediated signaling .

  • Alternative splicing mechanisms: Similar to what has been observed in pigs, humans may produce functional 5-TM GNRHR2 variants through alternative splicing and alternative start codons .

What are the potential physiological roles of GNRHR2 in reproductive and non-reproductive tissues?

Based on current research, GNRHR2 may play diverse roles in multiple tissues:

  • Reproductive cancer regulation: GnRH2 and its receptor are implicated in the regulation of cell proliferation, apoptosis, and metastasis in reproductive cancers, including breast, endometrial, and ovarian cancers .

  • Cell migration and invasion control: GNRHR2 activation can modulate cell migration and invasion properties in various cancer cell types, suggesting potential roles in metastasis regulation .

  • Growth factor signaling modulation: GNRHR2 signaling can attenuate the effects of growth factors like EGF by inhibiting receptor autophosphorylation and downstream signaling pathways .

  • Reproductive function regulation: Although less understood than GNRHR1's role in the hypothalamic-pituitary-gonadal axis, GNRHR2 may contribute to additional aspects of reproductive physiology, particularly in peripheral reproductive tissues.

How does GNRHR2 expression differ between normal and cancerous tissues?

Research indicates significant differences in GNRHR2 expression between normal and malignant tissues:

Cancer TypeGNRHR2 Expression PatternResearch FindingsReference
Breast CancerOverexpressed in cancer vs. normal tissueGnRH2 mRNA was overexpressed in cancerous versus normal breast tissue; approximately 2-fold greater expression in malignant compared to normal tissue
Endometrial CancerDetected in cancer cell linesProtein corresponding to 5-TM GNRHR2 (43-kDa) detected in Ishikawa and HEC-1A cells
Ovarian CancerPresent in cancer cell linesImmunostaining identified GNRHR2 in ovarian cancer samples; 5-TM GNRHR2 isoform (43-kDa) detected in EFO-21 and SK-OV-3 cells

Furthermore, in breast cancer, GnRH2 expression levels correlate with indices of poorer prognosis, suggesting potential prognostic value .

What mechanisms underlie the anti-proliferative effects of GnRH2 on cancer cells?

The anti-proliferative effects of GnRH2 on various cancer cells involve multiple mechanisms:

  • Disruption of growth factor signaling: GnRH2 agonists can interrupt epidermal growth factor (EGF) signaling by:

    • Inhibiting EGF receptor autophosphorylation

    • Suppressing activation of mitogen-activated protein kinases (MAPKs), particularly ERK1/2

    • Activating phosphotyrosine phosphatase, which reduces EGF receptor activation

  • Activation of specific signaling pathways:

    • p38 MAPK activation, which can be reversed by specific inhibitors like SB203580

    • ERK1/2 involvement in mediating anti-proliferative effects

    • PKC-dependent signaling pathways

  • Downregulation of translation machinery: In breast cancer cells, GnRH2 has been shown to downregulate proteins required for translation and cell proliferation .

  • Apoptosis induction: GnRH2 can induce apoptosis in endometrial cancer cells via caspase-3 activation and suppression of AKT and ERK1/2 activity .

How do GnRH2 effects on cancer cell migration and invasion differ between cell types?

Research has revealed complex and sometimes contradictory effects of GnRH2 on cancer cell migration and invasion:

  • Cell-type dependent responses:

    • In ovarian cancer cells, low doses of GnRH2 promoted invasion in OVCAR-3 cells (with elevated GNRHR1 expression) but not in SKOV-3 cells (with low GNRHR1 expression) .

    • GnRH2 and EGF worked synergistically to promote invasion of OVCAR-3 and CaOV-3 cells, but not SKOV-3 cells .

  • Receptor expression influence:

    • Differences in invasive responses to GnRH2 may be related to varying levels of receptor expression between cell lines .

    • Both SKOV-3 and OVCAR-3 cells express GNRHR2, but comparative expression levels have not been thoroughly investigated .

  • Pro-metastatic mechanisms:

    • In some cell types, GnRH2 enhances production of the 37-kDa laminin receptor precursor

    • Increased tumor cell interactions with laminin in the extracellular matrix

    • Enhanced matrix metalloproteinase-2 (MMP-2) production

  • Anti-metastatic mechanisms:

    • In other contexts, GnRH2 may inhibit metastatic processes through disruption of growth factor signaling and suppression of cell proliferation .

These variable effects suggest that the impact of GnRH2 on metastatic potential may depend on the specific molecular and cellular context.

What are the optimal approaches for studying GNRHR2 function in human cells?

To effectively study GNRHR2 function in human cells, researchers should consider the following approaches:

  • Cell model selection:

    • Choose cell lines with documented GNRHR2 expression (e.g., SK-OV-3, which expresses GNRHR2 but has low/negligible GNRHR1 expression) .

    • Consider comparative studies using multiple cell lines with different receptor expression profiles.

  • Receptor isolation strategies:

    • Implement GNRHR1 knockout/knockdown to isolate GNRHR2-mediated effects.

    • Use selective ligands: GnRH2 has higher affinity for GNRHR2, while triptorelin is selective for GNRHR1 .

  • Functional assays:

    • Proliferation assays with GnRH2 treatment, with and without growth factors (e.g., EGF)

    • Apoptosis detection using caspase activation assays

    • Migration and invasion assays to assess metastatic potential

    • Signaling pathway analysis focusing on p38 MAPK, ERK1/2, and PKC activation

  • Validation approaches:

    • Use specific pathway inhibitors (e.g., SB203580 for p38 MAPK) to confirm mechanisms

    • Combine genetic manipulation with pharmacological approaches

What are the challenges in developing recombinant GNRHR2 proteins for research applications?

Developing recombinant human GNRHR2 proteins presents several significant challenges:

  • Structural complexities:

    • The predicted human GNRHR2 contains a frameshift and premature stop codon, complicating full-length protein expression .

    • The functional form may be a 5-TM variant rather than the canonical 7-TM structure, requiring specific expression strategies .

  • Expression system considerations:

    • Mammalian expression systems may be preferred over bacterial systems to ensure proper post-translational modifications.

    • Chimeric constructs combining portions of the human gene with sequences from species that express functional receptors may be necessary.

  • Verification challenges:

    • Confirming proper folding and membrane insertion of the expressed protein

    • Validating functionality through ligand binding and signaling assays

    • Distinguishing between GNRHR1 and GNRHR2 activities in heterologous expression systems

  • Stabilization requirements:

    • G protein-coupled receptors often require stabilizing mutations or fusion partners to maintain structural integrity during expression and purification.

    • The putative 5-TM structure of human GNRHR2 may present unique stabilization challenges compared to typical 7-TM GPCRs.

What are the most promising therapeutic applications of targeting GNRHR2 in reproductive cancers?

Based on current research, several promising therapeutic applications emerge:

  • Combination therapies:

    • GnRH2 agonists combined with conventional chemotherapeutics to enhance efficacy

    • GnRH2 analogues with tamoxifen for hormone-resistant breast cancers (GnRH2 agonists have been shown to reverse 4OH-tamoxifen insensitivity)

  • Targeted anti-cancer approaches:

    • Development of GnRH2 analogues specifically targeting cancer cells expressing GNRHR2

    • Exploitation of the potent anti-proliferative effects of GnRH2, which in some studies outperform GnRH1 analogues

  • Anti-metastatic therapies:

    • Targeting the pathways through which GnRH2 modulates cell migration and invasion

    • Developing approaches to inhibit MMP-2 activation and laminin interactions in cancer cells

  • Biomarker applications:

    • Utilizing GNRHR2 expression patterns for cancer diagnosis or prognosis

    • Developing personalized treatment approaches based on receptor expression profiles

What unresolved questions about GNRHR2 structure and function should future research address?

Several critical questions remain unanswered regarding GNRHR2:

  • Structural characterization:

    • Definitive determination of whether humans express a functional 5-TM GNRHR2 variant

    • Structural studies to understand how a 5-TM receptor might function compared to canonical 7-TM GPCRs

  • Signaling mechanisms:

    • Complete elucidation of GNRHR2-specific signaling pathways distinct from GNRHR1

    • Understanding how receptor expression levels influence signaling outcomes and physiological responses

  • Physiological relevance:

    • Determination of the normal physiological roles of GNRHR2 in non-cancerous tissues

    • Investigation of potential endocrine, paracrine, and autocrine functions across diverse tissues

  • Cancer biology:

    • Resolution of conflicting data regarding pro- vs. anti-metastatic effects in different cancer cell types

    • Understanding how GNRHR2 expression correlates with cancer progression and patient outcomes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.