Recombinant Human Putative high affinity immunoglobulin gamma Fc receptor IC (FCGR1C)

Shipped with Ice Packs
In Stock

Description

Recombinant FCGR1C in Research Applications

Recombinant FCGR1C is primarily used in immunoassays to quantify its presence in biological samples. For example:

FCGR1C ELISA Kit (KTE61939)

ParameterDescription
MethodSandwich ELISA
Detection RangeInquire-specific (designed for low-abundance detection)
SensitivityHigh sensitivity with no cross-reactivity to analogues
Sample TypesSerum, plasma, cell culture supernatants
SupplierAbbkine

This kit employs immobilized anti-FCGR1C antibodies and biotin-conjugated detection antibodies, enabling precise measurement of FCGR1C levels .

3.1. Role in Cancer Prognosis

FCGR1C mRNA is upregulated in clear cell renal cell carcinoma (ccRCC), correlating with poor clinical outcomes :

3.2. Functional Associations

FCGR1C co-expresses with immune-related genes (e.g., C1QA, CD86) and is enriched in pathways such as phagocytosis and cytokine signaling :

CategoryAssociated Genes/Pathways
Immune ResponseComplement activation (C1QA/B/C), adaptive immunity (CD4, CD86)
KEGG PathwaysFcγR-mediated phagocytosis, Toll-like receptor signaling

Controversies and Limitations

  • Pseudogene Status: FCGR1C’s lack of transmembrane domains challenges its functional relevance, though its detectable expression suggests regulatory or soluble roles .

  • Assay Variability: Discrepancies in mRNA vs. protein expression levels (e.g., downregulated protein in ccRCC despite mRNA upregulation) .

Future Directions

Research priorities include elucidating FCGR1C’s role in immune modulation and its potential as a biomarker for cancers like ccRCC. Engineered recombinant variants could clarify its interaction with IgG or immune complexes.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs unless otherwise specified. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
16-280
Protein Length
Full Length of Mature Protein
Target Names
FCGR1C
Target Protein Sequence
QVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNGTATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWPLLQVSSRVFTEGEPLALRCHAWKDKLVYNVLYYRNGKAFKFFHWNSNLTILKTNISHNGTYHCSGKGKHHYTSAGISQYTVKGLQLPTPVWFHVLFYLAVGIMFLVNTVLWVTIRKELKRKKKWNLEISLDSGHEKKVISSLQEDRHLEEELKCQEQKEEQLQEGVHRKEPQGAT
Uniprot No.

Q&A

What is FCGR1C and how does it relate to other Fc gamma receptors?

FCGR1C is one of three highly homologous genes (A, B, and C) that share approximately 98% identity at the nucleotide level for the human CD64 group . While FCGR1A encodes the functional high-affinity Fc gamma RI receptor (CD64), FCGR1C is considered a duplicated pseudogene .

The Fc gamma receptor family is divided into three main classes based on their extracellular domain homology: FcγRI (CD64), FcγRII (CD32), and FcγRIII (CD16). These receptors interact with the Fc portion of IgG antibodies, serving as a critical link between humoral and innate immunity . Unlike functional Fc gamma receptors that participate in immune processes including phagocytosis, antibody-dependent cellular cytotoxicity (ADCC), and immune complex clearance, FCGR1C's pseudogene status suggests altered functionality.

What genetic features characterize FCGR1C compared to functional Fc gamma receptors?

FCGR1C contains stop codons within the membrane-proximal Ig-like domain, suggesting it may encode a secreted receptor or non-functional protein . The genes for the Fc gamma R family are located on chromosome 1, with FCGR1 on 1q21.2 and the other FCGR genes (including FCGR2 and FCGR3) on 1q23.3 .

The genomic organization of the FCGR locus is complex, with frequent copy number variations (CNVs) due to non-allelic homologous recombination events . Four CNV regions (CNRs) have been identified that can undergo deletion or duplication, contributing to significant diversity in receptor expression and function across populations .

Methodologically, researchers studying FCGR1C should employ approaches that can distinguish it from the highly homologous FCGR1A and FCGR1B, such as:

  • Primers targeting unique regions or stop codons

  • Next-generation sequencing with high coverage

  • Multiplex ligation-dependent probe amplification (MLPA)

  • Restriction enzyme digest variant ratio (REDVR) assays

What experimental approaches are effective for detecting FCGR1C expression?

Due to high sequence homology with other FCGR1 genes, researchers should consider these approaches:

  • Quantitative RT-PCR with primers targeting unique regions of FCGR1C

  • RNA sequencing with computational approaches to distinguish between similar transcripts

  • Digital droplet PCR for absolute quantification and better discrimination

  • Single-cell RNA sequencing to identify cell-specific expression patterns

  • In situ hybridization with probes designed to distinguish FCGR1C

When interpreting results, researchers should note that as a pseudogene, FCGR1C may have regulatory functions through its RNA rather than producing functional protein. Expression analyses indicate that FCGR1C mRNA levels are upregulated in certain cancer types, particularly clear cell renal cell carcinoma (ccRCC), compared to normal tissues .

How can researchers produce recombinant FCGR1C for functional studies?

For producing recombinant FCGR1C for research:

  • Expression System Selection: Mammalian expression systems (HEK293, CHO cells) are generally preferred to ensure proper folding and post-translational modifications.

  • Construct Design Considerations:

    • Express the extracellular domain only

    • Consider modifications to remove premature stop codons

    • Include purification tags (e.g., His-tag) similar to approaches used for recombinant FcγRI

  • Purification Protocol:

    • Implement multi-step purification including affinity chromatography

    • Follow with size exclusion chromatography for higher purity

    • Verify protein integrity through SDS-PAGE and Western blotting

    • Consider lyophilization from a filtered PBS solution for storage

  • Quality Control Measures:

    • Confirm identity through mass spectrometry

    • Evaluate purity by SDS-PAGE (aiming for >95% as with other recombinant proteins)

    • Assess potential functionality through binding assays compared to FCGR1A

What methodologies are appropriate for investigating FCGR1C's potential regulatory functions?

Despite being a pseudogene, FCGR1C transcription may have functional consequences through various regulatory mechanisms:

  • RNA-Based Functional Assays:

    • RNA immunoprecipitation to identify protein interactions

    • Competition assays for microRNA binding

    • RNA interference approaches targeting FCGR1C transcripts

    • Reporter gene assays to assess regulatory activity

  • Expression Manipulation Studies:

    • Overexpression systems to assess impact on related genes

    • CRISPR-based approaches for knockdown or knockout

    • Antisense oligonucleotides targeting specific regions

    • Inducible expression systems for time-course studies

  • Readout Measurements:

    • Assessment of impact on FCGR1A/B expression levels

    • Immune function assays (phagocytosis, ADCC, cytokine production)

    • Transcriptome analysis after manipulation

    • Epigenetic profiling to identify regulatory changes

How can CRISPR-Cas9 gene editing be optimized for studying FCGR1C function?

CRISPR-Cas9 approaches for FCGR1C research must address the challenges of high sequence homology:

  • Guide RNA Design Strategy:

    • Target unique SNPs or indels specific to FCGR1C

    • Use multiple bioinformatic tools to predict off-target effects

    • Consider paired nickase approaches for improved specificity

    • Validate guide efficiency with T7 endonuclease assays

  • Editing Applications:

    • Knockout studies to assess phenotypic effects

    • CRISPRa/CRISPRi for modulation without sequence alteration

    • HDR-mediated tagging for tracking endogenous expression

    • Base editing for specific nucleotide modifications

  • Validation Requirements:

    • Sequencing confirmation of intended edits

    • Off-target analysis using unbiased approaches

    • Expression verification via multiple methods

    • Functional assessment in relevant immune contexts

How does FCGR1C expression correlate with cancer prognosis?

Research has shown significant correlations between FCGR1C expression and cancer outcomes:

GeneCoefficientZ_valueHRLower (95%)Upper (95%)P-value
FCGR1C0.71554.27992.04521.47382.8382<0.0001
  • Research Methodology for Prognosis Studies:

    • Kaplan-Meier survival analysis stratified by expression level

    • Cox proportional hazards regression adjusting for clinical variables

    • Correlation with other established prognostic markers

    • Multivariate analysis to establish independent prognostic value

  • Mechanistic Hypotheses:

    • Potential regulatory impact on functional Fc gamma receptor expression

    • Influence on immune cell infiltration patterns

    • Modulation of antibody-dependent immune functions

    • Role in shaping tumor microenvironment

What methods can be used to study FCGR1C roles in autoimmune disorders?

While direct evidence for FCGR1C in autoimmunity is emerging, several methodological approaches can advance understanding:

  • Genetic Association Studies:

    • Sequence FCGR1C in autoimmune disease cohorts

    • Correlate variants with disease susceptibility and severity

    • Examine copy number variations in case-control studies

    • Perform meta-analyses across multiple autoimmune conditions

  • Expression Analysis Approaches:

    • Compare FCGR1C expression in affected tissues versus controls

    • Correlate with autoantibody levels and immune complex deposition

    • Single-cell analysis to identify relevant immune cell populations

    • Longitudinal studies during disease flares and remissions

  • Functional Validation:

    • Manipulate FCGR1C expression in patient-derived cells

    • Assess impact on immune complex handling

    • Measure changes in antibody-dependent cellular functions

    • Evaluate effects on therapeutic antibody efficacy

How should researchers investigate FCGR1C's potential role in infectious disease responses?

To study FCGR1C in infectious contexts, consider these approaches:

  • Expression Profiling:

    • Compare FCGR1C levels during acute and convalescent infection phases

    • Analyze expression in different immune cell populations during infection

    • Correlate with pathogen load and disease severity

    • Examine in the context of antibody-dependent enhancement phenomena

  • Genetic Association Methods:

    • Case-control studies of FCGR1C variants in infection outcome cohorts

    • Family-based association testing for infection susceptibility

    • Haplotype analysis of the FCGR locus in relation to disease outcomes

    • Copy number variation analysis in severe versus mild disease

  • Functional Investigations:

    • In vitro infection models with FCGR1C manipulation

    • Assessment of antibody-dependent enhancement mechanisms

    • Evaluation of immune complex clearance efficiency

    • Analysis of vaccination responses stratified by FCGR genotype

What methods are most effective for analyzing FCGR1C copy number variations?

The complex structure of the FCGR locus requires specialized approaches for CNV analysis:

  • Gold Standard Approaches:

    • Multiplex ligation-dependent probe amplification (MLPA) has been successfully used to study FCGR CNVs

    • Restriction enzyme digest variant ratio (REDVR) assays for confirmation

    • Digital droplet PCR for absolute quantification

    • Paralog ratio tests for relative copy number determination

  • Next-Generation Methods:

    • Long-read sequencing (Oxford Nanopore, PacBio) for resolving complex structural variants

    • Linked-read technologies to resolve haplotype-specific CNVs

    • Optical mapping for large structural rearrangements

    • Bioinformatic pipelines specifically designed for highly homologous regions

  • Validation and Quality Control:

    • Use multiple orthogonal methods for confirmation

    • Include samples with known copy numbers as controls

    • Account for population-specific CNV patterns

    • Consider familial studies to confirm inheritance patterns

Studies have identified significant population differences in FCGR CNVs, with some populations like those from Llano Grande, Ecuador, showing that 77.8% of individuals carry at least one CNR1 duplication (affecting FCGR2C and FCGR3B genes) .

How can researchers investigate the three-dimensional structure of putative FCGR1C protein products?

Despite its pseudogene status, understanding FCGR1C's potential structure offers insights into its evolution and possible functions:

  • Computational Approaches:

    • Homology modeling based on crystal structures of related FcγRs

    • In silico correction of premature stop codons to model hypothetical full-length protein

    • Molecular dynamics simulations to assess structural stability

    • Protein-protein interaction interface prediction

  • Experimental Structural Biology:

    • Express and purify domains for biochemical characterization

    • Circular dichroism spectroscopy for secondary structure analysis

    • Surface plasmon resonance for interaction studies

    • X-ray crystallography or cryo-EM if expression of stable domains is achieved

  • Functional Structural Assessment:

    • Identify potentially functional domains despite truncation

    • Assess binding capabilities with IgG subclasses

    • Compare with known structures of FCGR1A

    • Evaluate potential for heterotypic interactions with other receptors

How might non-coding functions of FCGR1C transcripts influence immune regulation?

As a pseudogene, FCGR1C may exert regulatory functions through RNA-based mechanisms:

  • Regulatory RNA Investigation Approaches:

    • RNA pulldown followed by mass spectrometry to identify protein partners

    • CHART or RAP-MS for comprehensive RNA-associated protein identification

    • RNA-RNA interaction mapping using CLASH or PARIS technologies

    • Transcriptome analysis after FCGR1C knockdown/overexpression

  • Potential Regulatory Mechanisms to Explore:

    • Competitive endogenous RNA (ceRNA) activity

    • MicroRNA sponging capabilities

    • Antisense regulation of related FCGR genes

    • Formation of regulatory RNA-protein complexes

  • Functional Assessment Methods:

    • Reporter assays with predicted target sequences

    • CRISPR interference targeting FCGR1C transcripts

    • RNA stability and localization studies

    • Correlation analyses in relevant disease states

What epigenetic mechanisms regulate FCGR1C expression, and how can they be studied?

DNA methylation plays a crucial role in regulating FCGR gene expression . Research approaches include:

  • Methylation Analysis Techniques:

    • Bisulfite sequencing of the FCGR1C promoter region

    • Methylation-specific PCR for targeted analysis

    • Pyrosequencing for quantitative methylation assessment

    • Genome-wide methylation arrays with FCGR locus coverage

  • Chromatin Structure Investigation:

    • ChIP-seq for histone modification patterns

    • ATAC-seq for chromatin accessibility

    • Hi-C or similar techniques for three-dimensional chromatin organization

    • CUT&RUN for precise transcription factor binding analysis

  • Functional Epigenetic Studies:

    • Treatment with demethylating agents to assess expression changes

    • CRISPR-based epigenetic editors targeting the FCGR1C locus

    • Correlation of methylation patterns with expression in disease contexts

    • Single-cell epigenomic analyses to capture cellular heterogeneity

Studies in clear cell renal cell carcinoma have shown that high DNA methylation levels of FcγRs lead to low mRNA and protein expression, correlating with poor prognosis .

What are the challenges in differentiating between FCGR1A, FCGR1B, and FCGR1C in experimental settings?

The high sequence homology between FCGR genes presents significant technical challenges:

  • Key Discrimination Challenges:

    • 98% sequence identity at nucleotide level

    • Similar expression patterns in several cell types

    • Cross-reactivity of antibodies and nucleic acid probes

    • Complex copy number variations affecting quantification

  • Advanced Discrimination Methods:

    • Single-molecule real-time sequencing for full-length analysis

    • Allele-specific PCR targeting unique SNPs or indels

    • Digital droplet PCR with highly specific probes

    • Custom capture approaches for targeted sequencing

    • CRISPR-based tagging of endogenous loci

  • Rigorous Validation Requirements:

    • Multiple method verification of findings

    • Controls including cells with known FCGR genotypes

    • Sequential discrimination approaches

    • Careful interpretation acknowledging potential cross-reactivity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.