Recombinant Human Putative L-type amino acid transporter 1-like protein IMAA (SLC7A5P2)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Human Putative L-type amino acid transporter 1-like protein IMAA (SLC7A5P2) is a protein that, in humans, is encoded by the SLC7A5P2 gene . It is also known as solute carrier family 7 member 5 pseudogene 2 . The SLC7A5P2 gene is located on chromosome 16 .

Gene Location

The SLC7A5P2 gene is found on chromosome 16 . Its genomic sequence can be found in various sources :

  • NC_000016.10 Chromosome 16 Reference GRCh38.p14 Primary Assembly

  • NW_017852933.1 Chromosome 16 Reference GRCh38.p14 PATCHES

  • NC_060940.1 Chromosome 16 Alternate T2T-CHM13v2.0

  • NC_000016.9 Chromosome 16 Reference GRCh37.p13 Primary Assembly

Function and Characteristics

SLC7A5P2 is categorized as a pseudogene, which means it shares sequence similarity with a protein-coding gene but has lost its protein-coding ability due to mutations . It is similar to the L-type amino acid transporter 1 (LAT1), which is known to transport essential amino acids across the blood-brain barrier and into cancer cells .

SLC7A Family and Cancer

The solute carrier family 7 (SLC7A) includes several members involved in transporting amino acids, and some of these members have been implicated in cancer . For instance, SLC7A5, a related protein, is known to interact with SLC3A2 and functions as a high-affinity transporter for large neutral amino acids . Studies suggest that SLC7A3, SLC7A4, and SLC7A5 could serve as diagnostic and prognostic biomarkers in breast cancer .

GEPIA (Gene Expression Profiling Interactive Analysis) data indicates that the expression of certain SLC7A family genes, including SLC7A2, SLC7A4, SLC7A5, and SLC7A13, is significantly and positively correlated with tumor stages in breast cancer patients .

SLC Transporters and Drug Action

Solute carriers (SLCs) are the largest family of transmembrane transporters in humans and are crucial determinants of cellular metabolism . Research has identified several SLCs that are important for the fitness of HAP1 cells, including SLC35B1 and MTCH2 . SLC transporters, such as SLC35F2, can mediate resistance to drugs like YM155 . سلش7آ5 is also related to the control of sensitivity by the voltage-sensing domain of Kv1 .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. To prioritize a specific tag, please inform us during your order placement.
Synonyms
SLC7A5P2; IMAA; MMAA; Putative L-type amino acid transporter 1-like protein IMAA; hLAT1 3-transmembrane protein IMAA; hLAT1 3TM IMAA; hLAT1 3-transmembrane protein MMAA; hLAT1 3TM MMAA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SLC7A5P2
Target Protein Sequence
MAGAGPKRRALAAPVAEEKEEAREKMMAAKRADGAAPAGEGEGVTLQGNITLLKGVAVIV VAIMSSGIFVTPTGVLKEAGSPGLALVVWAACGVFSIVGALCYAELGTTISKSGGDYAYM LDVYGSLPAFLKLWIELLIIRPSSQYIVALVFATYLLKPLFPTCPVPEEAAKLVACHSVQ LIVHQPTQVI
Uniprot No.

Target Background

Database Links

HGNC: 24951

UniGene: Hs.448808

Protein Families
Amino acid-polyamine-organocation (APC) superfamily, L-type amino acid transporter (LAT) (TC 2.A.3.8) family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in peripheral blood mononuclear cells and lymphoid and myeloid cell lines.

Q&A

How does SLC7A5P2 differ from functional L-type amino acid transporters in the SLC7 family?

Unlike functional members of the SLC7 family such as SLC7A5 (LAT1) and SLC7A8 (LAT2), SLC7A5P2 lacks the complete coding sequence and protein expression capability of active transporters . Functional L-type amino acid transporters like SLC7A5 form heterodimers with SLC3A2 to create amino acid exchange systems that transport neutral amino acids across cell membranes . These functional transporters play critical roles in various tissues including renal proximal tubule, small intestine, and the blood-brain barrier . SLC7A5P2, being a pseudogene, does not form these functional complexes but may interact with the regulatory machinery controlling expression of active transporters.

What methodologies are recommended for confirming SLC7A5P2 expression in tissue samples?

To confirm SLC7A5P2 expression, researchers should employ a multi-method approach. Begin with RT-qPCR using primers specific to unique regions of SLC7A5P2 that distinguish it from SLC7A5. Design these primers to span predicted intron-exon boundaries specific to SLC7A5P2. RNA sequencing provides another robust method, particularly when analyzed with bioinformatic pipelines capable of distinguishing pseudogene expression from parent genes. For transcript verification, northern blot analysis using probes designed to unique regions of SLC7A5P2 can help confirm transcript size and abundance . When examining potential regulatory functions, RNA immunoprecipitation techniques may reveal interactions between SLC7A5P2 RNA and regulatory proteins or microRNAs. Chromatin immunoprecipitation (ChIP) assays can identify if SLC7A5P2 locus has active chromatin marks, suggesting transcriptional activity.

What CRISPR/Cas9 strategies are most effective for studying SLC7A5P2 function?

When designing CRISPR/Cas9 approaches for SLC7A5P2 research, specificity is paramount due to sequence similarity with SLC7A5. Develop an SLC-focused CRISPR/Cas9 library with at least six single guide RNAs (sgRNAs) per target gene, taking particular care to avoid sequences sharing similarity with other SLC or ABC transporters . For validation, create multiple independent knockout cell lines using different sgRNAs targeting SLC7A5P2 to control for off-target effects. The FACS-based Multicolor Competition Assay (MCA) provides an effective validation method, where cells carrying sgRNAs targeting SLC7A5P2 and expressing eGFP are mixed at a 1:1 ratio with control sgRNA cells expressing mCherry . This allows for direct competitive growth assessment under various experimental conditions.

For phenotypic validation, implement complementation studies by reintroducing SLC7A5P2 constructs resistant to the sgRNA used. When analyzing potential regulatory functions, combine CRISPR interference (CRISPRi) or CRISPR activation (CRISPRa) approaches to modulate SLC7A5P2 expression without completely removing the genomic locus.

How can researchers effectively distinguish between SLC7A5P2 and SLC7A5 in functional studies?

Distinguishing between SLC7A5P2 and SLC7A5 requires meticulous experimental design. First, employ isoform-specific knockdown strategies using siRNAs or shRNAs targeting unique regions of each transcript. When designing constructs for overexpression studies, use epitope tags to differentiate between the potential products . For RNA-level distinction, design custom branched DNA (bDNA) probes for in situ hybridization that target unique regions of each transcript.

When assessing potential regulatory relationships, implement perturbation studies where SLC7A5P2 is modulated and effects on SLC7A5 expression are quantified using RT-qPCR, western blotting, and functional transport assays. Employ subcellular fractionation techniques to determine if SLC7A5P2 transcripts localize differently than SLC7A5 mRNAs, potentially indicating distinct regulatory functions. Cross-linking immunoprecipitation (CLIP) assays can identify if SLC7A5P2 transcripts interact with RNA-binding proteins that might influence SLC7A5 expression .

What protein analysis techniques should be used to investigate potential protein products of SLC7A5P2?

Despite SLC7A5P2's classification as a pseudogene, thorough protein analysis is essential to conclusively determine if any functional protein products exist. Begin with western blot analysis using sensitive detection methods and antibodies raised against predicted open reading frames within SLC7A5P2 . For comprehensive proteomic identification, implement liquid chromatography-mass spectrometry/mass spectrometry (LC-MS/MS) analysis with both data-dependent acquisition (DDA-MS) and data-independent acquisition (DIA-MS) modes to maximize detection sensitivity .

Sample preparation should include enrichment strategies such as immunoprecipitation with custom antibodies against predicted SLC7A5P2 peptides. Analysis parameters should include: precursor mass tolerance of 8 ppm, fragment mass tolerance of 0.02 Da, and variable modifications including phosphorylation . Set peptide identification thresholds at a false discovery rate (FDR) ≤1%. For validation of any detected peptides, parallel reaction monitoring (PRM) or selected reaction monitoring (SRM) can provide targeted quantification of specific peptides of interest .

How might SLC7A5P2 influence the mTOR signaling pathway in neuronal development?

SLC7A5P2, as a pseudogene of SLC7A5, may indirectly affect mTOR signaling through regulatory interactions with SLC7A5 expression. The functional SLC7A5 transporter imports amino acids required to maintain mTOR activity, which is crucial for neuronal development . To investigate SLC7A5P2's potential role in this pathway, researchers should employ knockdown experiments using shRNAs targeting SLC7A5P2 in neural stem cells or neuronal models and assess effects on mTOR pathway activity using phospho-specific antibodies against key mTOR targets like p70S6K and 4E-BP1 .

Western blot analysis should quantify phosphorylation states of mTOR pathway components, while immunohistochemistry can provide spatial information on pathway activation in neuronal structures. To establish causality, rescue experiments using Ras homolog enriched in brain (Rheb), an mTOR activator, can determine if mTOR pathway activation can reverse phenotypes observed after SLC7A5P2 knockdown . Time-course experiments are essential to distinguish between direct regulatory effects and secondary consequences of long-term SLC7A5P2 modulation on mTOR signaling.

What experimental approaches can determine if SLC7A5P2 regulates SLC7A5 expression?

To establish if SLC7A5P2 regulates SLC7A5 expression, implement a comprehensive regulatory analysis workflow. Begin with correlation studies examining SLC7A5P2 and SLC7A5 expression levels across multiple cell types and tissues using RT-qPCR and western blotting. Then perform perturbation experiments using overexpression and knockdown of SLC7A5P2 to observe effects on SLC7A5 transcript and protein levels .

For mechanistic insights, employ RNA immunoprecipitation to identify if SLC7A5P2 transcripts interact with miRNAs that might target SLC7A5. Luciferase reporter assays using the SLC7A5 promoter can determine if SLC7A5P2 affects transcriptional activity. Chromosome conformation capture techniques might reveal if the SLC7A5P2 locus physically interacts with the SLC7A5 gene locus, suggesting enhancer-like functions. Perform CRISPR activation (CRISPRa) experiments targeting the SLC7A5P2 locus to determine if increased transcription from this region affects SLC7A5 expression. Finally, RNA stability assays using actinomycin D can reveal if SLC7A5P2 affects SLC7A5 mRNA half-life .

How can researchers investigate the potential role of SLC7A5P2 in neurological disorders?

Investigating SLC7A5P2's potential role in neurological disorders requires a multifaceted approach. Given that mutations in related transporters like SLC7A5 cause microcephaly and seizures, SLC7A5P2 variants should be examined in patient cohorts with similar phenotypes . Begin with targeted sequencing of the SLC7A5P2 locus in neurological disorder patient cohorts, followed by functional characterization of any identified variants using in vitro and in vivo models.

For functional studies, employ electroporation of SLC7A5P2 or shRNA constructs into subventricular zone neural stem cells, as demonstrated with SLC7A5, and assess effects on neuronal development, dendrite maturation, and survival . Implement CRISPR/Cas9-mediated introduction of patient-specific variants into neural organoids and evaluate consequences on brain development using immunohistochemistry for neuronal markers, dendrite complexity analysis, and electrophysiological recordings .

For mechanism-based investigations, examine if SLC7A5P2 variants affect mTOR pathway activity, as dysregulation of this pathway is implicated in many neurological conditions. Measure phosphorylation states of key mTOR targets in patient-derived cells or model systems expressing SLC7A5P2 variants using western blotting with phospho-specific antibodies against mTOR pathway components .

What methodologies should be employed to study potential associations between SLC7A5P2 variants and cancer drug resistance?

To investigate associations between SLC7A5P2 variants and cancer drug resistance, implement a structured approach beginning with genomic analysis. Conduct targeted sequencing of SLC7A5P2 in matched pairs of drug-sensitive and drug-resistant cancer cell lines and patient samples. Correlate expression levels of SLC7A5P2 with drug response profiles across cancer cell line panels using RT-qPCR and RNA sequencing .

For functional validation, create isogenic cell lines with CRISPR/Cas9-mediated knockouts or overexpression of SLC7A5P2 and assess changes in drug sensitivity using dose-response curves and cell viability assays. Follow this with drug transport studies to determine if SLC7A5P2 affects uptake of specific compounds, particularly those that are known substrates of related transporters like SLC7A5 .

To identify potential drug associations, screen SLC7A5P2-modulated cells against libraries of cytotoxic compounds using methods similar to those described for other SLC transporters, where cells lacking specific SLCs are treated with multiple concentrations of compounds (typically at 1×, 3×, and 10× the IC50) . For mechanistic investigations, employ phosphoproteomic analysis using LC-MS/MS to identify altered signaling pathways in cells with SLC7A5P2 modulation, setting cutoff values for fold change at >5 or <0.2 for GO and biological process analyses .

How might the evolutionary conservation of SLC7A5P2 inform its functional significance?

Investigating the evolutionary conservation of SLC7A5P2 provides critical insights into its potential functional significance. Begin with comparative genomic analysis across primate species to determine if SLC7A5P2 emerged recently or is more ancient. Calculate the ratio of synonymous to non-synonymous substitutions (dN/dS ratio) in regions with open reading frames to assess selective pressure . Lower ratios suggest purifying selection and functional constraint, which would be unexpected for a true pseudogene.

Implement cross-species transcriptome analysis to determine if SLC7A5P2 is expressed in orthologous regions in other mammals. Examine the conservation of potential regulatory elements within and surrounding the SLC7A5P2 locus using chromatin accessibility and histone modification data across species. For functional validation of conserved regions, employ CRISPR/Cas9-mediated deletion of conserved elements followed by assessment of effects on neighboring gene expression, particularly SLC7A5 .

Analyze the secondary structure conservation of SLC7A5P2 RNA across species using computational predictions and chemical probing methods, as conserved RNA structures may indicate functional RNA elements with regulatory roles independent of protein-coding capacity.

What biophysical techniques can be used to study potential RNA-protein interactions involving SLC7A5P2 transcripts?

To characterize RNA-protein interactions involving SLC7A5P2 transcripts, employ multiple complementary biophysical approaches. Begin with RNA immunoprecipitation (RIP) using antibodies against RNA-binding proteins suspected to interact with SLC7A5P2, followed by RT-qPCR to detect enrichment of SLC7A5P2 transcripts . For unbiased identification of protein partners, implement RNA pulldown assays using biotinylated SLC7A5P2 RNA followed by mass spectrometry to identify bound proteins.

Enhanced specificity can be achieved through crosslinking immunoprecipitation (CLIP) methods, particularly individual-nucleotide resolution CLIP (iCLIP) or photoactivatable ribonucleoside-enhanced CLIP (PAR-CLIP), which provide nucleotide-resolution binding maps . Biolayer interferometry or surface plasmon resonance can determine binding kinetics and affinities between purified RNA-binding proteins and synthetic SLC7A5P2 RNA fragments.

For structural characterization of these interactions, employ small-angle X-ray scattering (SAXS) or cryo-electron microscopy (cryo-EM) with reconstituted RNA-protein complexes. Nuclear magnetic resonance (NMR) spectroscopy can provide atomic-resolution insights into the structural basis of specific interactions between protein domains and SLC7A5P2 RNA motifs. Validate functional significance of identified interactions through mutagenesis of binding sites followed by functional assays in cellular models .

How can systems biology approaches integrate SLC7A5P2 into broader amino acid transport networks?

Integrating SLC7A5P2 into amino acid transport networks requires sophisticated systems biology approaches. Begin with correlation network analysis of expression data across tissue types and physiological conditions to identify genes whose expression patterns correlate with SLC7A5P2, particularly other SLC transporters and amino acid metabolism genes . Construct protein-protein interaction networks by performing immunoprecipitation of SLC7A5 and related transporters followed by mass spectrometry to determine if regulatory proteins might be influenced by SLC7A5P2.

Use metabolomic profiling coupled with SLC7A5P2 perturbation to map changes in amino acid levels and metabolism. Apply flux balance analysis to model the impact of SLC7A5P2-mediated changes on amino acid transport rates and cellular metabolic states. For regulatory network reconstruction, perform integrated analysis of transcriptomic, proteomic, and epigenomic data from cells with modulated SLC7A5P2 expression .

Implement Kinase-Substrate Enrichment Analysis using the PhosphoSitePlus kinase-substrate database (p-value cutoff: 0.05, substrate count cutoff: 10) to identify signaling pathways potentially influenced by SLC7A5P2 . To validate computational predictions, perform targeted perturbation experiments focused on key nodes identified in the network analysis, measuring effects on amino acid transport using radioisotope-labeled amino acids or fluorescent amino acid analogs.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.