Recombinant Human Putative membrane-spanning 4-domains subfamily A member 4E (MS4A4E)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Human Putative membrane-spanning 4-domains subfamily A member 4E (MS4A4E) is a protein that, along with most members of the MS4A family, contains at least four potential transmembrane domains and N- and C-terminal cytoplasmic domains . The MS4A4E protein, also known as Membrane Spanning 4-Domains A4E, is encoded by distinct exons . The protein has a role in lipid homeostasis and macrophage-mediated phagocytosis . MS4A4E binds to APOA1 and may have a function in apolipoprotein-mediated phospholipid efflux from cells .

Predicted Functions and Associations

MS4A4E interacts with several proteins, including MS4A6A, MS4A6E, MS4A10, MS4A12, ABCA7, CD33, CLU, PICALM, CD2AP, and MS4A8 . These interactions suggest its involvement in various cellular processes .

Functional Associations of MS4A4E

CategoryDescription
Functional TermEncompasses a wide array of functional annotations.
Phrase or ReferenceIncludes textual references and phrases associated with MS4A4E.
DiseaseDiseases associated with the MS4A4E gene in GWAS datasets.
Phenotype or TraitPhenotypes and traits linked to MS4A4E.
Structural FeatureStructural aspects of the MS4A4E protein.
Cell LineCell lines expressing the MS4A4E gene.
Cell Type or TissueCell types and tissues where MS4A4E is expressed.
GeneOther genes that interact with MS4A4E.
ProteinProteins that interact with MS4A4E.
microRNAmicroRNAs associated with MS4A4E.
Predicted Protein Domain AnnotationsProtein domains predicted for MS4A4E protein from the InterPro Predicted Protein Domain Annotations dataset .

Expression

MS4A4E exhibits variable expression levels across different tissues and cell types .

Role in Lipid Homeostasis

MS4A4E plays a role in lipid homeostasis, specifically in macrophage-mediated phagocytosis . It binds to apolipoprotein A1 (APOA1) and may function in apolipoprotein-mediated phospholipid efflux from cells .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MS4A4E; Putative membrane-spanning 4-domains subfamily A member 4E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-132
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
MS4A4E
Target Protein Sequence
MTTMQGMEQTTPGAGPDVPQLGNIDVIHSYLCKGLQEKFFKRKPKVLGVVRILIALMSLS MGIIMMCVAFSSYEEHPIFVYVAYTIWGSVMYPYQLQQELEQQKVWNYLKNLSWRIMGSY LCFGERSELKPL
Uniprot No.

Target Background

Database Links

HGNC: 14284

OMIM: 608401

UniGene: Hs.559934

Protein Families
MS4A family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is MS4A4E and what is its genomic location?

MS4A4E (membrane spanning 4-domains A4E) belongs to the MS4A family of proteins that typically contain at least four potential transmembrane domains with N- and C-terminal cytoplasmic domains encoded by distinct exons . The gene is located on chromosome 11q12.2 and spans positions 60200270 to 60243137 on the complement strand according to the NC_000011.10 assembly . MS4A4E contains 12 exons in total . Most MS4A genes, including MS4A4E, are characterized by their tetraspan structure and may function as ion channels or modulators of other immune receptors .

How is MS4A4E expression measured in research?

Researchers typically measure MS4A4E expression using several methodologies:

  • RNA-sequencing: Commonly used to quantify transcript levels and compare expression between normal and disease tissues. This approach has been employed in studies analyzing MS4A4E expression in glioma and lung cancer .

  • Allele-specific expression analysis: This technique examines whether specific alleles affect gene expression differently, as demonstrated in studies of Alzheimer's disease-associated variants .

  • ROC curve analysis: Utilized to assess the diagnostic efficiency of MS4A4E mRNA levels in disease contexts. For example, MS4A4E showed good predictive power (AUC > 0.7) as a potential biomarker for glioma diagnosis .

What expression patterns does MS4A4E show in normal vs. disease states?

Expression patterns vary significantly by disease context:

This differential expression pattern suggests that MS4A4E may play context-dependent roles in different cancer types.

What is the significance of MS4A4E in Alzheimer's disease research?

MS4A4E has gained significant attention in Alzheimer's disease (AD) research due to its genetic interactions, particularly with the CLU gene. The MS4A4E locus was initially identified in genome-wide association studies of late-onset Alzheimer's disease . Further research revealed that the interaction between specific variants in CLU and MS4A4E significantly modulates AD risk, with a greater effect than many other established AD risk loci .

How does the CLU-MS4A4E interaction affect Alzheimer's disease risk?

The interaction between specific variants in CLU (rs11136000) and MS4A4E (rs670139) has been replicated in multiple large-scale studies:

  • The interaction demonstrates a synergy factor of 2.23 (p=0.0004)

  • The observed odds ratio for the interaction is 2.45, which is higher than most established AD risk loci except APOE ε4 (OR=3.68), APP (OR=5.29), and TREM2 (OR=5.05)

  • The combined population attributable fraction (cPAF) is 8.0, suggesting that elimination of both risk alleles could potentially decrease AD incidence by approximately 8%

This strong epistatic effect represents a rare result in AD research: a potent gene-gene interaction replicated across multiple independent datasets .

What specific variants are involved in the CLU-MS4A4E interaction?

The key interaction involves:

  • CLU variant: rs11136000 (particularly the C/C genotype)

  • MS4A4E variant: rs670139 (particularly the G/G genotype)

Research suggests that the rs670139 variant may be located in the 3'UTR of MS4A4E (according to gene model XM_011545416.1), though gene models differ. 3'UTR variants can potentially affect transcription and translation processes .

How does APOE ε4 status influence the CLU-MS4A4E interaction in Alzheimer's disease?

Analysis of the interaction stratified by APOE ε4 status revealed:

  • A significant association between the CLU-MS4A4E interaction and AD case-control status exists in APOE ε4 negative subjects (SF = 2.08, p = 0.004)

  • No significant association was found in APOE ε4 positive subjects (SF = 1.19, p = 0.26)

This three-way interaction provides valuable insight into AD risk and protective factors. Previous research has shown that CLU has a stronger association in APOE ε4 positive individuals, while the region surrounding MS4A4E has a stronger association in APOE ε4 negative individuals .

What is known about potential dominant or dosage effects of MS4A4E variants?

Statistical analyses comparing the effect estimates of homozygous and heterozygous interactions between CLU and MS4A4E variants suggest a potential dominant effect for the rs670139 G allele in MS4A4E. While the homozygous interaction (rs11136000 C/C—rs670139 G/G) was significant, evidence also points to a heterozygous effect (rs11136000 C/C—rs670139 G/T) .

The lack of significant difference between homozygous and heterozygous effect sizes suggests that heterozygous individuals may be at similar risk compared to homozygous individuals, indicating a dominant rather than dosage effect. This has important implications for understanding disease heritability and epidemiological patterns .

What potential causal variants have been identified linked to MS4A4E?

Exploration of causal variants in the MS4A4E region identified:

  • Two SNPs in MS4A4E (rs2081547 and rs11230180) with a Regulome DB score of '1f', indicating they are known to modify gene expression and function as DNase and transcription factor binding sites

  • These SNPs have been shown to modify MS4A4A expression (the gene upstream from MS4A4E)

  • According to gene model XM_011545416.1, rs670139 itself is in the MS4A4E 3'UTR, which could affect transcription and translation

Further analysis of these variants is necessary to better understand their involvement in Alzheimer's disease pathophysiology.

What biological pathways and functions is MS4A4E associated with?

Gene Ontology and pathway analyses indicate MS4A4E and related MS4A family members are associated with:

Biological processes:

  • Regulation of leukocyte differentiation

  • Negative regulation of immune system processes

  • Regulation of transforming growth factor beta production

  • Negative regulation of lymphocyte and leukocyte activation

  • Negative regulation of cytokine production

Molecular functions:

  • Tau protein binding

  • Clathrin binding

  • Cargo receptor activity

  • Phosphatidylcholine transporter activity

  • Vascular endothelial growth factor receptor binding

Gene Set Enrichment Analysis (GSEA) has further implicated MS4A4E in:

  • TNF-α via NF-kB signaling

  • IL6/JAK/STAT3 signaling

  • IFN-γ response

  • IFN-α response

  • Epithelial-mesenchymal transition (EMT)

How does MS4A4E expression correlate with immune cell infiltration?

MS4A4E expression significantly correlates with immune cell infiltration in various disease contexts. In glioma, MS4A4E expression is associated with infiltration of various immune cell types, including:

  • B cells

  • CD8+ T cells

  • CD4+ T cells

  • Macrophages

  • Neutrophils

  • Dendritic cells

Similarly, in lung cancer, the expression of MS4A family genes, including MS4A4E, significantly correlates with immune cell infiltration . This suggests that MS4A4E may play important roles in modulating the tumor immune microenvironment.

What experimental approaches should be considered when studying MS4A4E function?

Based on current research approaches, recommended experimental methods include:

  • Gene knockdown/knockout studies: To assess the functional impact of MS4A4E on cellular phenotypes, similar to studies that showed knockdown of related family member TMEM176B suppresses malignant properties of glioma cells .

  • Protein-protein interaction analyses: To explore potential interactions with other proteins, particularly CLU, which shows statistical epistasis with MS4A4E .

  • Allele-specific expression experiments: To determine how specific variants affect MS4A4E expression in different cellular contexts .

  • Immunohistochemistry: To evaluate protein expression in different tissues and disease states.

  • Co-immunoprecipitation: To validate potential protein-protein interactions suggested by statistical epistasis.

What are the challenges in distinguishing statistical vs. biological epistasis for MS4A4E?

A significant challenge in MS4A4E research involves distinguishing between statistical epistasis (interaction detected in genetic association studies) and biological epistasis (actual molecular interaction between gene products). For MS4A4E and CLU:

Experimental validation through protein interaction studies and functional assays is necessary to bridge this gap between statistical and biological epistasis.

How might understanding MS4A4E contribute to therapeutic approaches?

The estimated population attributable fraction of 8.0 for the CLU-MS4A4E interaction suggests targeting the associated pathways could potentially reduce AD incidence by approximately 8% . Potential therapeutic approaches could include:

  • Targeting the specific signaling pathways involving both CLU and MS4A4E

  • Developing compounds that modulate the expression or function of MS4A4E

  • Pursuing personalized medicine approaches based on genotype at both loci, particularly considering the potential dominant effect of the rs670139 G allele

  • Exploring immunomodulatory approaches given MS4A4E's associations with immune-related pathways

What methodological approaches are recommended for studying MS4A4E in diverse disease contexts?

Given MS4A4E's divergent expression patterns and potentially opposing roles in different cancers versus neurodegenerative diseases, researchers should consider:

  • Context-specific analysis: Evaluating MS4A4E in specific cellular and tissue contexts rather than generalizing across diseases

  • Multi-omics integration: Combining genomic, transcriptomic, and proteomic data to understand how genetic variants influence expression and function

  • Cell-type specific studies: Investigating MS4A4E in specific cell populations, particularly given its associations with immune cells

  • Longitudinal designs: Assessing how MS4A4E expression and effects change during disease progression

  • Comparative studies across diseases: Systematically comparing MS4A4E's role across neurodegenerative diseases and cancers to identify common and divergent mechanisms

How effective is MS4A4E as a prognostic biomarker?

MS4A4E shows promise as a prognostic biomarker, but with disease-specific patterns:

In glioma:

In lung cancer:

  • Lower MS4A4E expression correlates with poorer prognosis

  • Low MS4A4E expression is significantly associated with pathological stage

These opposing patterns highlight the context-dependent role of MS4A4E and suggest it may function differently in various cancer types.

What methodological considerations are important when analyzing MS4A4E variants in disease association studies?

When studying MS4A4E variants in disease association:

  • Account for epistatic effects: Traditional single-SNP analyses may miss important effects that only emerge through gene-gene interactions, as demonstrated with CLU-MS4A4E

  • Stratify by APOE status: Given the differential effects observed in APOE ε4 positive versus negative individuals, stratification by APOE status is critical

  • Consider dominant vs. additive models: Evidence suggests a dominant effect for MS4A4E variants, which affects the choice of genetic models in association studies

  • Adjust for population structure: Use appropriate statistical methods (logistic regression, generalized estimating equations) with adjustment for population substructure to avoid false associations

  • Utilize meta-analysis and joint analysis approaches: Combining data across multiple cohorts increases power and reliability, as demonstrated in the ADGC studies

  • Apply permutation testing: Empirical p-values obtained from permutations provide additional validation of association findings

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.