Recombinant Human Putative neuropeptide Y receptor type 6 (NPY6R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will then fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a preferred tag type, please inform us, and we will prioritize its inclusion during development.
Synonyms
NPY6R; NPY1RL; Y2B; Putative neuropeptide Y receptor type 6; NPY6-R; NPY Y1-like receptor; Putative pancreatic polypeptide receptor 2; PP2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MEVSLNHPASNTTSTKNNNSAFFYFESCQPPSPALLLLCIAYTVVLIVGLFGNLSLIIII FKKQRKAQNFTSILIANLSLSDTLVCVMCIHFTIIYTLMDHWIFGDTMCRLTSYVQSVSI SVSIFSLVFTAVERYQLIVNPRGWKPSVTHAYWGITLIWLFSLLLSIPFFLSYHLTDEPF RNLSLPTDLYTHQVACVENWPSKKDRLLFTTSLFLLQYFVPLGFILICYLKIVICLRRRN AKVDKKKENEGRLNENKRINTMLISIVVTFGACWLPRISSMSSLTGIMRC
Uniprot No.

Target Background

Function
When expressed, this protein is unable to bind pancreatic polypeptide (PP), neuropeptide Y (NPY), or peptide YY (PYY), suggesting that it might be functionally inactive or may have acquired a pancreatic polypeptide-independent function.
Database Links

HGNC: 7959

OMIM: 601770

UniGene: Hs.643466

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in heart, skeletal muscle, gastrointestinal tissues, spleen, brain and adrenal glands.

Q&A

What is the basic structural characterization of NPY6R and how does it differ from other NPY receptors?

NPY6R belongs to the G protein-coupled receptor family that responds to neuropeptide Y (NPY). Unlike other NPY receptors (Y1, Y2, and Y4), which display distinct binding patterns with NPY peptides, NPY6R exhibits specific structural properties that determine its function. The binding pose of NPY peptides varies significantly between receptor subtypes. For instance, when NPY binds to Y1 receptor, its N-terminus shifts toward ECL3 and binds deeper within the helical bundle, whereas in Y2 receptor, the peptide N-terminus stacks on top of the C-terminal region of ECL2 . These structural differences between NPY receptors inform our understanding of NPY6R's likely binding properties.

Experimental techniques to determine NPY6R structure typically involve:

  • X-ray crystallography

  • Cryo-electron microscopy

  • Computational modeling

  • Site-directed mutagenesis to identify key binding residues

How can I design controlled experiments to study NPY6R signaling pathways?

When designing controlled experiments to study NPY6R signaling, it is critical to clearly define your independent and dependent variables. The independent variable (what you manipulate) might be NPY6R expression levels or ligand concentration, while the dependent variable (what you measure) could be downstream signaling molecules, calcium flux, or cellular responses .

A methodologically sound approach includes:

  • Establishing clear controls:

    • Positive controls (known NPY receptor activators)

    • Negative controls (receptor-free systems)

    • Vehicle controls (buffer/solvent only)

  • Maintaining consistent experimental conditions:

    • Temperature and pH during assays

    • Cell passage numbers

    • Incubation times

    • Expression levels of recombinant receptors

  • Data collection guidelines:

    • Record at least six data points for robust analysis

    • Ensure the independent variable spans at least a 10-fold range

    • Present data in logically ordered tables with appropriate units

    • Include all controlled variables in your documentation

What are the optimal expression systems for producing functionally active recombinant NPY6R?

The expression of functionally active recombinant NPY6R presents several challenges due to its membrane protein nature. Based on approaches used for related NPY receptors, several expression systems can be considered:

  • Mammalian expression systems (HEK293, CHO cells)

    • Advantages: Native post-translational modifications, proper folding

    • Protocol modifications: Addition of signal peptides (e.g., hemagglutinin) and epitope tags (e.g., Flag tag at N-terminus, twin-strep-tag at C-terminus) can improve expression while maintaining functionality, as demonstrated with Y1R, Y2R, and Y4R receptors

  • Insect cell expression (Sf9, High Five)

    • Beneficial for structural studies requiring higher protein yields

    • May require optimization of culture conditions and infection parameters

  • Cell-free expression systems

    • Allows rapid screening of constructs

    • May require specialized detergents for functional reconstitution

When designing your expression construct, consider:

  • Removing flexible C-terminal regions (similar to the approach with Y1R where residues R341-I384 were replaced)

  • Verifying that modifications do not affect receptor signaling through functional assays

  • Using inducible expression systems to control expression levels

What methodological approaches can resolve contradictory data in NPY6R binding assays?

When confronted with contradictory binding data for NPY6R, consider these methodological approaches:

  • Analyze the influence of G protein coupling:

    • For related NPY receptors (Y1R and Y2R), G protein coupling significantly enhances ligand affinity (10 to 100-fold enhancement observed)

    • In contrast, Y4R can achieve high-affinity ligand binding without G protein stabilization

    • Test if NPY6R follows patterns more similar to Y1R/Y2R or Y4R

  • Examine experimental conditions that may affect binding parameters:

    • Membrane preparation methods (isolated membranes vs. intact cells)

    • Buffer composition, particularly ions that may influence receptor conformation

    • Temperature and incubation time variations

    • Presence of potential allosteric modulators

  • Implement multiple binding assay technologies:

    • Radioligand binding

    • Time-resolved fluorescence resonance energy transfer (TR-FRET)

    • Bioluminescence resonance energy transfer (BRET)

    • Surface plasmon resonance (SPR)

  • Conduct data analysis using multiple mathematical models:

    • One-site vs. two-site binding models

    • Competitive vs. allosteric binding models

    • Apply statistical tests to determine which model best fits your data

How can NPY6R expression be evaluated as a potential biomarker in uveal melanoma?

NPY6R has demonstrated significant prognostic value in uveal melanoma (UVM). Research indicates that NPY6R is poorly expressed in most tumors and associates with better prognosis in UVM patients . To evaluate NPY6R as a biomarker:

  • Expression analysis methods:

    • Quantitative RT-PCR for mRNA expression levels

    • Immunohistochemistry for protein localization and expression

    • Western blotting for semi-quantitative protein analysis

    • RNA-seq for comprehensive transcriptome analysis

  • Diagnostic value assessment:

    • The area under the curve (AUC) value for NPY6R in UVM diagnosis was found to be 0.676 (95% CI: 0.556–0.795)

    • Sensitivity and specificity calculations should be performed for various NPY6R expression thresholds

    • Comparison with existing biomarkers is essential for determining added value

  • Clinical correlation analysis:

    • NPY6R expression has been found to be lower in male UVM patients

    • Create a nomogram incorporating NPY6R with other clinical predictors for enhanced prognostic accuracy

    • Analyze relationships between NPY6R expression and treatment responses

  • Immune microenvironment correlations:

    • Apply ESTIMATE and CIBERSORT algorithms to calculate immune cell fractions and infiltration percentages

    • Correlate NPY6R expression with immune cell profiles for potential immunotherapy implications

What experimental designs can best investigate the functional role of NPY6R in tumor progression?

To investigate NPY6R's functional role in tumor progression, consider these experimental approaches:

  • Gene modulation studies:

    • Knockdown/knockout using CRISPR-Cas9 or siRNA

    • Overexpression using viral vectors

    • Inducible expression systems to study temporal effects

    • Domain-specific mutations to identify functional regions

  • Functional assays to evaluate:

    • Cell proliferation (MTT, BrdU incorporation)

    • Migration and invasion (transwell, wound healing)

    • Apoptosis (Annexin V/PI staining, caspase activity)

    • Angiogenesis (tube formation, VEGF expression)

  • In vivo models:

    • Xenograft models with NPY6R-modulated cells

    • Patient-derived xenografts

    • Genetically engineered mouse models

    • Metastasis models to assess invasive potential

  • Pathway analysis:

    • Phosphorylation studies of downstream signaling molecules

    • Transcriptome analysis after NPY6R modulation

    • Proteomic approaches to identify interacting partners

    • Gene set enrichment analysis (GSEA) to identify associated pathways

Experimental ApproachAdvantagesLimitationsKey Controls
CRISPR-Cas9 knockoutComplete protein eliminationPotential off-target effectsNon-targeting gRNA
siRNA knockdownRapid implementationIncomplete silencingScrambled siRNA
OverexpressionModels gain-of-functionNon-physiological levelsEmpty vector
Xenograft modelsIn vivo tumor biologySpecies differencesVehicle-treated animals
Patient-derived modelsClinical relevanceTumor heterogeneityMultiple patient samples

How should researchers analyze and interpret NPY6R expression data across different tissue types?

When analyzing NPY6R expression across tissues, robust data analysis approaches are essential:

  • Normalization strategies:

    • Use multiple reference genes for qPCR normalization

    • Apply appropriate normalization methods for microarray or RNA-seq data

    • Consider tissue-specific reference genes rather than global references

  • Statistical analysis:

    • Apply parametric tests (t-test, ANOVA) when data is normally distributed

    • Use non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) for non-normal distributions

    • Correct for multiple comparisons using Bonferroni, Benjamini-Hochberg, or other appropriate methods

  • Data visualization:

    • Create heatmaps for multi-tissue expression patterns

    • Use box plots to show distribution of expression levels

    • Apply principal component analysis to identify patterns across tissues

  • Interpretation framework:

    • Compare with evolutionary related receptors (Y1, Y2, Y4) for context

    • Correlate with tissue-specific functions

    • Examine co-expression with known interacting partners

    • Interpret in light of pathway enrichment analysis results

What are the best approaches for analyzing the relationship between NPY6R expression and immune cell infiltration?

To analyze relationships between NPY6R expression and immune cell infiltration:

  • Computational deconvolution methods:

    • CIBERSORT algorithm can be used to estimate the percentage of infiltrating immune cells

    • ESTIMATE algorithm helps calculate the fraction of immune cells

    • xCell or MCP-counter for additional validation

  • Correlation analysis:

    • Pearson or Spearman correlation between NPY6R expression and immune cell scores

    • Multivariate regression to account for confounding factors

    • Time-series analysis for dynamic studies

  • Functional immune assays:

    • Multiplex cytokine analysis in relation to NPY6R expression

    • Flow cytometry validation of predicted immune cell profiles

    • Co-culture experiments with immune cells and NPY6R-expressing cells

  • Graphical representation of relationships:

    • Scatter plots with correlation coefficients

    • Network visualization of immune-NPY6R interactions

    • Heat maps showing hierarchical clustering

When interpreting these relationships, consider:

  • Direct vs. indirect effects of NPY6R on immune cells

  • Reverse causality (do immune cells affect NPY6R expression?)

  • Tissue-specific immune environments

  • Disease context variations

How can researchers design experiments to characterize NPY6R binding specificity with different ligands?

To characterize NPY6R binding specificity:

  • Experimental design considerations:

    • Use a range of structurally diverse ligands (full-length NPY, truncated variants, related peptides)

    • Test concentration ranges spanning at least a 10-fold difference

    • Include both orthosteric and potential allosteric binding sites

    • Compare with other NPY receptor subtypes for selectivity profiles

  • Binding assay selection:

    • Saturation binding to determine Bmax and Kd values

    • Competition binding to determine Ki values for multiple ligands

    • Kinetic binding to determine association/dissociation rates

    • Thermodynamic analysis (ITC) to measure binding energetics

  • Structural considerations based on related receptors:

    • The N-terminus of NPY forms extensive interactions with Y1 receptor but not with Y2 and Y4 receptors

    • Different receptors require different peptide regions for full activity (Y1R and Y4R require full-length N-terminus for full agonist activity)

    • Design truncated or modified peptides to probe specificity determinants

  • Conformational analysis:

    • Investigate if NPY6R binding induces conformational changes similar to those observed in other NPY receptors (outward shift of helix VI ~9 Å and inward movement of helix VII ~4 Å)

    • Mutagenesis of key binding residues identified from homology modeling

What analytical techniques are recommended for resolving contradictory functional data in NPY6R research?

When faced with contradictory functional data in NPY6R research:

  • Systematic variation of experimental conditions:

    • Test multiple cell lines to rule out cell-specific effects

    • Vary receptor expression levels to identify potential artifacts

    • Examine the influence of experimental buffers and additives

    • Assess temporal aspects of signaling (rapid vs. sustained responses)

  • Orthogonal assay approaches:

    • Measure multiple signaling outputs (cAMP, calcium, ERK phosphorylation)

    • Combine optical (BRET/FRET) with biochemical readouts

    • Assess membrane vs. internalized receptor populations

    • Examine biased signaling through different G protein subtypes or β-arrestin pathways

  • Advanced data analysis:

    • Apply operational models of receptor activation

    • Use kinetic modeling to capture time-dependent effects

    • Perform global fitting across multiple datasets

    • Consider allosteric interactions in mathematical models

  • Graphical analysis techniques:

    • Create plots showing relationships between variables to identify patterns

    • Test different mathematical models (linear, square, inverse relations) to fit your data

    • Use statistical tests to determine the best-fitting model

Relationship TypeMathematical ModelGraphical PatternExample in Receptor Studies
No Relationy = aHorizontal lineSaturated response
Direct Proportiony = axStraight line through originReceptor occupancy at low ligand concentrations
Linear Relationy = ax + bStraight line with y-interceptReceptor reserve systems
Square Relationy = ax²Parabolic curveCooperative binding systems

What are the most promising future research directions for understanding NPY6R's role in disease?

Based on current knowledge, these research directions hold significant promise:

  • Expanding disease associations beyond uveal melanoma:

    • Investigate NPY6R in other cancer types, particularly melanomas

    • Explore potential roles in metabolic diseases given NPY system's role in appetite regulation

    • Examine implications in neurological disorders where neuropeptide signaling is important

  • Structural biology approaches:

    • Cryo-EM structure determination of NPY6R in complex with ligands

    • Molecular dynamics simulations to understand binding mechanisms

    • Comparison with the determined structures of Y1, Y2, and Y4 receptors to identify unique features

  • Therapeutic targeting strategies:

    • Development of NPY6R-selective agonists and antagonists

    • Structure-based drug design informed by binding pocket characteristics

    • Exploration of allosteric modulators

    • Investigation of biased ligands that selectively activate beneficial pathways

  • Systems biology perspectives:

    • Integration of NPY6R into broader signaling networks

    • Multi-omics approaches to understand regulatory mechanisms

    • Machine learning to predict NPY6R-related biomarkers in various diseases

How should researchers design experiments to investigate potential gene-environment interactions affecting NPY6R function?

To investigate gene-environment interactions affecting NPY6R function:

  • Experimental design framework:

    • Define clear independent variables (genetic variants, environmental factors)

    • Select appropriate dependent variables (receptor expression, signaling outputs)

    • Control all other variables rigorously

    • Include sufficient biological replicates for statistical power

  • Genetic variation analysis:

    • Targeted sequencing of NPY6R and regulatory regions

    • CRISPR-based introduction of specific variants

    • Promoter analysis to identify regulatory elements

    • Epigenetic profiling (methylation, histone modifications)

  • Environmental factor testing:

    • Stress conditions (oxidative stress, hypoxia)

    • Nutrient availability

    • Inflammatory mediators

    • Endocrine disrupting chemicals

  • Analytical approaches:

    • Factorial experimental designs to test interaction effects

    • Two-way ANOVA for statistical analysis

    • Response surface methodology for complex interactions

    • Hierarchical modeling for nested experimental designs

  • Data recording and presentation:

    • Maintain comprehensive data tables with all relevant variables

    • Include controlled variables and their values

    • Calculate derived variables where appropriate

    • Present data in graphs with properly labeled axes and titles

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.