Recombinant Human Putative olfactory receptor 2W6 (OR2W6P)

Shipped with Ice Packs
In Stock

Description

Functional Role and Odorant Specificity

OR2W6P is classified as a putative odorant receptor, though its specific ligands remain under investigation. Key functional insights include:

  • Odorant Receptor Activity: Binds volatile chemical stimuli, initiating intracellular signaling via cAMP or Ca²⁺ pathways .

  • Structural Specificity: Like other olfactory receptors, OR2W6P likely recognizes structurally related odorants, as demonstrated for homologous receptors (e.g., OR17-40’s activation by helional) .

  • Combinatorial Coding: Predicted to contribute to odor perception through combinatorial activation patterns across multiple receptors, as shown in large-scale OR-odorant interaction studies .

Heterologous Expression Challenges

Olfactory receptors like OR2W6P require accessory proteins for proper trafficking to the cell membrane. Studies on RTP1/RTP2 proteins reveal their critical role in:

  • Enhancing OR surface expression in HEK293 cells .

  • Stabilizing receptor conformation during folding .

Functional Assays

  • HEK293 Cells: OR2W6P expressed in HEK293 cells shows utility in calcium imaging and Western blotting .

  • Xenopus laevis Oocytes**: Electrophysiological assays using co-expressed reporter channels enable odorant response quantification .

Key Research Applications

ApplicationDescription
Odorant ScreeningIdentifies ligands via high-throughput calcium imaging or electrophysiology .
Structural StudiesFacilitates crystallography and molecular dynamics simulations .
Disease ModelingInvestigates anosmia or neurodegenerative disorders linked to olfactory dysfunction .

Future Directions

  • Ligand Identification: High-throughput screening using OR2W6P-expressing cell lines could reveal its specific activators .

  • Mechanistic Studies: Elucidate its role in olfactory signaling cascades and potential cross-talk with other receptors .

  • Therapeutic Potential: Explore applications in biosensors or targeted drug delivery systems leveraging odorant specificity .

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format we have in stock, you may specify your desired format during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchasing method or location. Please contact your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is dependent on various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of your specified tag.
Synonyms
OR2W6P; OR2W7P; Putative olfactory receptor 2W6; Olfactory receptor OR6-3; Putative olfactory receptor 2W7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR2W6P
Target Protein Sequence
MGFYHVGQAAFELLTSSFILVGFSDRPHLELIVFVVVLIFYLLTLLGNMTIVLLSALDSR LHTPMYFFLANLSFLDMCFTTGSIPQMLYNLWGPDKTISYVGCAIQLYFVLALGGVECVL LAVMAYDRYAAVCKPLHYTIIMHPRLCGQLASVAWLSGFGNSLIMAPQTLMLPRCGHRRV DHFLCEMPALIGMACVDTMMLEALAFALAIFIILAPLILILISYGYVGGTVLRIKSAAGR KKAFNTCSSHLIVVSLFYGTIIYMYLQPANTYSQDQGKFLTLFYTIVTPSVNPLIYTLRN KDVKEAMKKVLGKGSAEI
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15072

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR2W6P and what is its biological function?

Putative Olfactory Receptor 2W6 (OR2W6P) is a member of the olfactory receptor family, which belongs to the G-protein coupled receptor 1 (GPCR) superfamily. It is classified as a "putative" receptor, indicating that while its sequence suggests olfactory receptor function, definitive experimental validation is still in progress . The protein consists of 318 amino acids and is encoded by the OR2W6P gene in humans .

Similar to other olfactory receptors such as OR2A2, OR2W6P likely functions as an odorant receptor that binds specific molecular structures . The "P" in its name suggests it may be a pseudogene, though functional studies are needed to conclusively establish its status and biological activity.

What structural and sequence characteristics define OR2W6P?

OR2W6P has a protein length of 318 amino acids, which is consistent with the typical structure of olfactory receptors . Like other members of the G-protein coupled receptor family, it likely contains seven transmembrane domains with an extracellular N-terminus and intracellular C-terminus. The protein is cataloged in UniProt with the accession number Q8NHA6 .

The amino acid region 240-320 appears to be particularly important, as evidenced by the development of specific antibodies targeting this region . This suggests that this portion of the protein may contain immunogenic epitopes that are accessible to antibodies, potentially indicating surface exposure or functional significance.

What is known about OR2W6P expression patterns?

The expression pattern of OR2W6P across different tissues remains an area requiring further investigation. Unlike some well-characterized olfactory receptors, comprehensive expression data for OR2W6P is limited. Researchers studying this receptor often need to perform their own expression analyses using techniques such as RT-PCR, RNA-seq, or immunohistochemistry with specific antibodies .

While traditional understanding suggests olfactory receptors are primarily expressed in nasal olfactory epithelium, growing evidence indicates many olfactory receptors show ectopic expression in non-olfactory tissues. These expression patterns may indicate additional physiological roles beyond odor detection. For OR2W6P specifically, expression studies using antibodies such as the rabbit polyclonal antibody against the 240-320 amino acid region can help elucidate its tissue distribution .

When designing expression studies, researchers should consider using positive controls with known expression patterns and multiple detection methods to validate findings, as olfactory receptor expression can be low in non-olfactory tissues and may require sensitive detection methods.

What antibodies and detection methods are available for OR2W6P research?

Commercially available antibodies specifically targeting OR2W6P include rabbit polyclonal antibodies such as the one described in the search results (STJ192897) . This antibody targets the amino acid region 240-320 of the human OR2W6P protein and has been validated for Western blot and ELISA applications . The antibody is reported to be affinity-purified from rabbit anti-serum by affinity-chromatography, suggesting good specificity .

For Western blot applications, the recommended dilution range is 1:500-2000, while for ELISA applications, a dilution range of 1:5000-20000 is suggested . The antibody is formulated in PBS with 50% glycerol and 0.02% sodium azide and should be stored at -20°C for up to one year from the date of receipt, avoiding repeated freeze-thaw cycles .

When using antibodies for OR2W6P detection, researchers should consider:

  • Including appropriate positive and negative controls to validate specificity

  • Optimizing blocking conditions to minimize background

  • Validating results with additional methods when possible

  • Testing cross-reactivity with other closely related olfactory receptors

How can recombinant OR2W6P be produced for research applications?

Production of recombinant olfactory receptors presents unique challenges due to their hydrophobic transmembrane domains. Based on approaches used for similar olfactory receptors, several expression systems can be considered for OR2W6P:

  • Bacterial expression systems (E. coli): While cost-effective, membrane proteins often form inclusion bodies requiring refolding. Fusion tags like MBP or SUMO can improve solubility.

  • Wheat germ cell-free expression systems: These have been successfully used for other olfactory receptors and might be suitable for OR2W6P . This system allows expression of membrane proteins without cellular toxicity issues.

  • Insect cell expression (Baculovirus): Offers eukaryotic post-translational modifications with higher yields than mammalian systems.

  • Mammalian cell expression: Provides native-like folding and post-translational modifications, though with typically lower yields.

When designing constructs for OR2W6P expression, researchers should consider:

  • Including purification tags (His, FLAG, etc.) that can be cleaved if necessary

  • Codon optimization for the expression host

  • Adding stabilizing mutations or fusion partners

  • Including glycosylation sites if using eukaryotic systems

The choice of detergent for extraction and purification is critical for maintaining protein stability and function. Common detergents used for GPCRs include DDM, LMNG, and digitonin.

What RNA interaction studies can be performed with OR2W6P?

The RNAct database provides predictions of RNA interactions for OR2W6P (UniProt: Q8NHA6), suggesting potential RNA binding properties . These predictions indicate several RNA transcripts that may interact with OR2W6P, with prediction scores ranging from approximately 32.5 to 34.7 and z-scores around 2.8-3.1 .

RNA TranscriptPrediction ScoreZ-Score
AC116565.1-20134.673.14
SEPT3-20434.243.07
TCF15-20133.933.02
RAB12-20133.582.97
FOXD1-20233.442.94

To validate and further study these predicted interactions, researchers can employ several experimental approaches:

  • RNA immunoprecipitation (RIP) using OR2W6P-specific antibodies

  • Cross-linking immunoprecipitation (CLIP) to identify direct binding sites

  • Electrophoretic mobility shift assays (EMSA) to confirm direct interactions

  • Fluorescence anisotropy to measure binding affinities

  • Surface plasmon resonance (SPR) for kinetic analyses of interactions

When designing RNA interaction studies, it's important to consider both direct binding and indirect associations through protein complexes. Controls should include non-specific RNAs and related proteins to establish specificity of the interactions.

How does OR2W6P compare to other olfactory receptors?

OR2W6P belongs to the large family of olfactory receptors, which in humans comprises approximately 400 functional genes and a similar number of pseudogenes. Comparing OR2W6P to other olfactory receptors like OR2A2 can provide insights into its potential function and evolutionary significance .

OR2A2, another member of the olfactory receptor family, shares structural characteristics with OR2W6P as both belong to the G-protein coupled receptor 1 family . Both proteins function as odorant receptors, though their specific ligand preferences may differ. While recombinant OR2A2 protein has been produced and is commercially available (such as a fragment spanning amino acids 261-318 expressed in wheat germ) , similar resources for OR2W6P are more limited.

Comparative sequence analysis between OR2W6P and other olfactory receptors can reveal:

  • Conserved functional domains

  • Unique sequence features that might indicate specialized functions

  • Evolutionary relationships and selection pressures

  • Potential pseudogene characteristics if present

Researchers investigating OR2W6P should consider conducting phylogenetic analyses to place this receptor in the context of the broader olfactory receptor family, which may provide insights into its functional significance.

What are the challenges in experimental design for OR2W6P functional studies?

Designing robust experiments to characterize the function of OR2W6P presents several challenges:

  • Expression system selection: As a membrane protein, OR2W6P requires careful consideration of expression systems. Each system (bacterial, insect, mammalian) offers trade-offs between yield, proper folding, and post-translational modifications.

  • Functional assay development: Determining the appropriate assays to evaluate OR2W6P function requires consideration of potential signaling pathways. Common approaches include:

    • Calcium imaging to detect receptor activation

    • cAMP accumulation assays

    • GTPγS binding assays

    • Receptor internalization studies

    • Bioluminescence resonance energy transfer (BRET) assays

  • Ligand identification: Identifying specific ligands that activate OR2W6P can be challenging due to the vast chemical space of potential odorants. High-throughput screening approaches or computational prediction methods may be necessary.

  • Antibody validation: Ensuring the specificity of antibodies against OR2W6P requires rigorous validation through multiple approaches . This is particularly important given the sequence similarity among olfactory receptors.

  • Distinguishing from pseudogene properties: The "P" in OR2W6P suggests it might be annotated as a pseudogene, requiring careful experimental design to determine if it produces functional protein or has regulatory roles as non-coding RNA.

How can computational approaches enhance OR2W6P research?

Computational methods offer valuable tools for OR2W6P research when experimental data is limited:

  • Homology modeling: Using solved structures of related GPCRs, researchers can build structural models of OR2W6P to predict ligand binding sites and interaction surfaces.

  • Molecular dynamics simulations: These can provide insights into protein flexibility, potential conformational changes upon activation, and stability in membrane environments.

  • RNA interaction prediction: As shown in the RNAct database results, computational approaches can predict potential RNA interaction partners for OR2W6P . These predictions can guide experimental validation.

  • Machine learning approaches: These can be used to predict:

    • Potential ligands based on physicochemical properties

    • Protein-protein interaction networks

    • Expression patterns across tissues

    • Functional effects of sequence variants

  • Evolutionary analysis: Comparative genomics can provide insights into conservation, selection pressure, and potential functional importance of different protein regions.

These computational approaches are particularly valuable for generating hypotheses that can be tested experimentally, especially for understudied proteins like OR2W6P.

What potential roles might OR2W6P have beyond olfaction?

Recent research on olfactory receptors has revealed functions beyond canonical olfaction. For OR2W6P, exploring these non-canonical roles represents an exciting research frontier. Potential non-olfactory functions may include:

  • Tissue-specific signaling: Ectopic expression in non-olfactory tissues may indicate roles in tissue-specific chemical sensing or signaling pathways.

  • Development and differentiation: Some olfactory receptors have been implicated in developmental processes and cell differentiation.

  • Immune modulation: Several GPCRs, including some olfactory receptors, have been linked to immune function regulation.

  • Metabolic sensing: Emerging evidence suggests some olfactory receptors may function as metabolic sensors in various tissues.

  • RNA regulatory functions: The predicted RNA interactions from RNAct database suggest potential roles in RNA regulation or metabolism .

Investigating these alternative functions requires tissue-specific expression studies, knockout/knockdown approaches, and functional assays beyond traditional olfactory signal transduction pathways.

How can genome-wide association studies inform OR2W6P research?

While the GWAS Catalog search showed no direct associations for OR2W6P , this does not rule out potential disease associations that might be discovered through more focused studies. Researchers interested in potential clinical relevance of OR2W6P should consider:

  • Targeted association studies: Focusing on specific phenotypes related to sensory perception or in tissues where OR2W6P is expressed.

  • eQTL analyses: Examining if genetic variants affect OR2W6P expression levels in different tissues.

  • Rare variant analyses: GWAS typically focuses on common variants; rare variant analyses might reveal associations not captured in large-scale studies.

  • Polygenic risk scores: Considering OR2W6P variants as part of broader genetic signatures associated with specific traits.

  • Cross-species comparisons: Examining phenotypes in model organisms with alterations in OR2W6P orthologs.

As more genomic and phenotypic data becomes available, researchers should periodically reexamine potential associations with OR2W6P to identify emerging patterns that were not evident in earlier studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.