Recombinant Human Putative olfactory receptor 52A4 (OR52A4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preferred format when placing your order, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for precise delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR52A4P; OR52A4; Olfactory receptor 52A4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-304
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
OR52A4P
Target Protein Sequence
MALPITNGTLFMPFVLTFIGIPGFESVQCWIGIPFCATYVIALIGNSLLLIIIKSEPSLH EPMYIFLATLGATDISLSTSIVPKMLDIFWFHLPEIYFDACLFQMWLIHTFQGIESGVLL AMALDRCVAICYPLRRAIVFTRQLVTYIVVGVTLRPAILVIPCLLLIKCHLKLYRTKLIY HTYCERVALVKLATEDVYINKVYGILGAFIVGGLDFIFITLSYIQIFITVFHLPLKEARL KVFNTCIPHIYVFFQFYLLAFFFIFYSQIWILYPIICTYHLVQSLPTGPTIPQPLYLWVK DQTH
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 19579

UniGene: Hs.553729

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of OR52A4?

OR52A4 exhibits the characteristic structural organization of functional G-protein coupled receptors, featuring seven transmembrane helices (TMHs) that span the cell membrane . The protein contains an extracellular amino terminus designed for ligand binding and an intracellular carboxy terminus responsible for signal transduction . This structural arrangement distinguishes functional olfactory receptors like OR52A4 from pseudogenes such as OR51V1 and OR51A1P, which contain only six transmembrane helices and have two extracellular termini rather than the functional arrangement .

The reference sequence for OR52A4 (NP_001005222.1) provides the primary sequence information necessary for computational modeling of protein structure . Researchers can predict the membrane topology of OR52A4 using web-based algorithms such as TMHMM (http://www.cbs.dtu.dk/services/TMHMM/), which generate models displaying the protein's transmembrane organization . Understanding this topology is crucial for investigations into ligand binding properties and activation mechanisms of the receptor.

When working with recombinant OR52A4, particularly partial constructs, careful attention must be paid to ensuring that all essential structural elements required for functional studies are preserved . The structural integrity of these domains directly impacts the receptor's ability to bind odorant molecules and transduce signals, making accurate structural characterization a prerequisite for meaningful functional studies.

How should researchers optimize storage conditions for recombinant OR52A4?

Storage optimization for recombinant OR52A4 requires consideration of multiple factors that affect protein stability and shelf life . The stability of recombinant OR52A4 depends on storage state (liquid vs. lyophilized), buffer composition, storage temperature, and the inherent stability properties of the protein itself . According to manufacturer guidelines, liquid formulations typically maintain stability for approximately 6 months when stored at -20°C to -80°C, while lyophilized preparations offer extended stability of up to 12 months under identical storage conditions .

To maintain optimal protein integrity, repeated freeze-thaw cycles should be strictly avoided as they accelerate protein degradation . For ongoing experiments, working aliquots may be stored at 4°C for a maximum of one week . Prior to use, vials containing recombinant OR52A4 should undergo brief centrifugation to ensure complete collection of the protein at the bottom of the container .

The reconstitution process significantly impacts protein stability and functionality . Recombinant OR52A4 should be reconstituted in deionized sterile water to achieve concentrations between 0.1-1.0 mg/mL . For long-term storage, glycerol addition to a final concentration of 5-50% is recommended, with 50% being a standard concentration used by many manufacturers . Following reconstitution, the protein should be divided into small working aliquots to minimize freeze-thaw cycles and stored at -20°C to -80°C for maximum stability .

What expression patterns does OR52A4 demonstrate in human tissues?

OR52A4 exhibits a notable expression pattern in human brain tissue, suggesting potential functions beyond the conventional role in olfactory perception . In comparative studies examining the six olfactory receptor genes affected by the 118 kb deletion associated with β-thalassemia (OR51V1, OR52Z1, OR51A1P, OR52A1, OR52A5, and OR52A4), researchers have documented varying expression levels in brain tissue .

The expression profile follows a distinctive pattern: OR51V1 shows the highest expression level (approximately 25-fold higher than OR51A1P, which exhibits the lowest expression) . OR52A4, together with the other functional genes (OR52Z1, OR52A1, and OR52A5), demonstrates intermediate expression levels—approximately 5-fold less than OR51V1 but relatively equivalent among these four functional receptors .

The presence of OR52A4 in brain tissue is particularly significant as it challenges the traditional view that olfactory receptors function exclusively in the olfactory epithelium . This extranasal expression suggests potential non-olfactory functions, possibly involving neuronal signaling or development pathways . Researchers investigating OR52A4 should consider both its canonical olfactory role and potential alternative functions in experimental design. Comprehensive tissue expression profiling using quantitative PCR or RNA sequencing would provide valuable insights into the complete expression landscape of OR52A4 across human tissues.

How does protein purity impact functional studies of recombinant OR52A4?

The purity of recombinant OR52A4 preparations significantly influences experimental outcomes, particularly in functional and structural studies . Commercial recombinant Human Putative olfactory receptor 52A4 typically achieves a purity level exceeding 85% as determined by SDS-PAGE analysis . While this purity level is adequate for many research applications, certain experimental approaches may require higher purity standards.

Contaminants in protein preparations can interfere with experimental results through multiple mechanisms. In ligand binding assays, contaminant proteins may compete with OR52A4 for ligand interactions, potentially leading to underestimated binding affinities or false negatives in screening assays. In functional studies measuring signal transduction, contaminating proteins with enzymatic activity might generate background signals that complicate interpretation of OR52A4-specific responses.

For researchers conducting advanced structural studies such as X-ray crystallography or cryo-electron microscopy, exceptionally high purity (typically >95%) is essential to achieve the sample homogeneity required for structural determination. Additionally, studies investigating protein-protein interactions or those employing surface plasmon resonance would benefit from higher purity preparations to minimize non-specific interactions.

To ensure experimental validity, researchers should verify protein purity using complementary analytical methods beyond SDS-PAGE, such as size exclusion chromatography, mass spectrometry, or Western blotting with OR52A4-specific antibodies. When necessary, additional purification steps including affinity chromatography, ion exchange chromatography, or size exclusion chromatography may be implemented to achieve higher purity levels required for specific applications.

What are the functional implications of OR52A4 deletion in β-thalassemia patients?

The homozygous deletion of OR52A4 in β-thalassemia patients presents a unique natural experiment for studying olfactory receptor function in humans . Individuals homozygous for the 118 kb deletion on chromosome 11 that causes β-thalassemia simultaneously lose six contiguous olfactory receptor genes: OR51V1, OR52Z1, OR51A1P, OR52A1, OR52A5, and OR52A4 . This complete absence of these receptors offers a rare opportunity to investigate their physiological roles.

Among the deleted receptors, OR52A4—along with OR52Z1, OR52A1, and OR52A5—is classified as a functional receptor based on structural characteristics, particularly the presence of seven transmembrane domains with appropriate termini configuration . The complete absence of these functional olfactory receptors raises important questions regarding potential alterations in olfactory perception and processing in affected individuals . While systematic assessment of olfactory function in β-thalassemia patients with this specific deletion has not been reported, such studies would be highly informative and could be conducted in populations where this mutation is prevalent, such as Malaysia, Indonesia, and the Philippines .

Beyond olfactory implications, the deletion may have broader physiological consequences due to potential non-olfactory functions of these receptors in the brain . Additionally, the finding that OR52A1 contains a γ-globin enhancer previously shown to influence the continuous expression of fetal γ-globin genes suggests potential regulatory relationships between these olfactory receptor genes and globin gene expression . This connection could have implications for understanding hemoglobin switching during development and might inform therapeutic approaches for β-thalassemia.

Research designs comparing olfactory perception profiles between β-thalassemia patients homozygous for the 118 kb deletion and matched controls could provide critical insights into specific olfactory modalities affected by the absence of these receptors, potentially linking particular odorants to OR52A4 and related receptors.

How can researchers effectively characterize OR52A4 ligand binding properties?

Characterizing the ligand binding properties of OR52A4 requires a multi-faceted approach that addresses the inherent challenges of working with membrane-bound G-protein coupled receptors . A comprehensive strategy combines computational predictions, heterologous expression systems, and functional assays to identify potential ligands and characterize binding interactions.

Initial computational approaches should leverage the structural characteristics of OR52A4, particularly its seven transmembrane domain architecture and extracellular amino terminus that forms the ligand binding pocket . Structure-based virtual screening using the reference sequence NP_001005222.1 can generate predictions about potential ligand chemotypes based on binding pocket geometry and physicochemical properties . Molecular docking simulations can further refine these predictions by estimating binding energies and identifying key interaction residues.

For experimental validation, heterologous expression systems provide platforms for functional testing . Mammalian cell lines such as HEK293 cells can be transfected with OR52A4 expression constructs coupled to appropriate reporter systems . Functional assays typically measure receptor activation through second messenger cascades, including calcium flux measurements, cAMP accumulation assays, or β-arrestin recruitment. High-throughput screening approaches utilizing automated liquid handling and detection systems enable testing of large compound libraries to identify potential agonists.

The unique situation of β-thalassemia patients homozygous for the 118 kb deletion offers an exceptional opportunity for in vivo validation studies . Psychophysical testing comparing olfactory perception profiles between these individuals (who completely lack OR52A4) and control subjects could identify specific odorants whose detection is compromised in the absence of OR52A4 . Such studies would require carefully designed protocols using standardized odorant panels and quantitative metrics of olfactory performance.

How should researchers design experiments to investigate OR52A4 expression in neural circuits?

Investigating OR52A4 expression and function in neural circuits requires specialized experimental approaches that address the challenges of studying specific receptor populations in complex neural networks . The documented expression of OR52A4 in brain tissue suggests roles beyond canonical olfactory processing, potentially in neuronal signaling or development .

Single-cell RNA sequencing provides a powerful approach for identifying specific neuronal populations expressing OR52A4 and characterizing their transcriptional profiles. This technique can reveal co-expression patterns with other receptors, ion channels, and signaling molecules, providing insights into the functional context of OR52A4-expressing neurons. Cell-type-specific transcriptomics comparing populations from normal individuals and those lacking OR52A4 (such as β-thalassemia patients with the 118 kb deletion) could identify compensatory mechanisms or downstream effects of OR52A4 absence.

For functional studies in neural circuits, CRISPR-Cas9 gene editing to introduce reporter tags (such as fluorescent proteins) into the endogenous OR52A4 locus enables visualization of expressing neurons and facilitates electrophysiological recording or calcium imaging following stimulation with potential ligands. Alternatively, viral vectors carrying OR52A4 expression constructs with activity-dependent reporters can be used to monitor receptor activation in specific neural populations.

Advanced techniques such as optogenetics or chemogenetics applied to OR52A4-expressing neurons would allow selective activation or inhibition of these cells, enabling investigation of their functional roles in neural circuits and behaviors. These approaches require careful consideration of promoter specificity to ensure targeted manipulation of the desired neuronal population.

What methodological approaches best elucidate OR52A4's relationship with the β-globin gene cluster?

The genomic proximity and potential functional relationship between OR52A4 and the β-globin gene cluster presents a fascinating area for investigation requiring specialized methodological approaches . The contiguous arrangement of six olfactory receptor genes (OR51V1, OR52Z1, OR51A1P, OR52A1, OR52A5, and OR52A4) near the β-globin gene cluster on chromosome 11 suggests possible regulatory relationships that may have implications for both olfactory function and hemoglobin production .

Chromosome conformation capture techniques represent powerful approaches for investigating three-dimensional genomic interactions between the OR gene cluster and β-globin locus . Methods such as 3C (Chromosome Conformation Capture), 4C (Circular Chromosome Conformation Capture), 5C (Carbon Copy Chromosome Conformation Capture), or Hi-C can reveal physical interactions between these genomic regions in different cell types and developmental stages. These techniques could identify potential regulatory loops involving OR52A4 and β-globin gene regulatory elements.

The finding that OR52A1 contains a γ-globin enhancer previously shown to influence the continuous expression of fetal γ-globin genes raises questions about similar regulatory elements in OR52A4 or coordinated regulation across this genomic region . To investigate this, ChIP-seq (Chromatin Immunoprecipitation Sequencing) analysis targeting transcription factors known to regulate globin genes could identify binding sites within OR52A4 and surrounding regions. Additionally, ATAC-seq (Assay for Transposase-Accessible Chromatin using sequencing) would reveal chromatin accessibility patterns across this locus in different cell types.

Functional validation using CRISPR-Cas9 genome editing enables precise manipulation of specific regulatory elements . Targeted deletion or mutation of potential regulatory regions within OR52A4 followed by assessment of globin gene expression would establish causative relationships. Conversely, artificial tethering of regulatory factors to specific sites using CRISPR activation/inhibition systems (CRISPRa/CRISPRi) could reveal the functional significance of specific genomic elements.

The naturally occurring 118 kb deletion in β-thalassemia patients provides a valuable model for studying these relationships . Comparative analysis of chromatin architecture and gene expression patterns between cells from individuals with and without this deletion could reveal how the absence of these olfactory receptor genes affects the broader regulatory landscape of the β-globin locus.

How should researchers design PCR primers for OR52A4 genotyping studies?

Effective PCR primer design for OR52A4 genotyping requires careful consideration of sequence specificity, genomic context, and experimental objectives . When designing primers for OR52A4 genotyping, researchers must address several critical factors to ensure accurate and reliable results.

First, researchers should obtain the most current reference sequence for OR52A4 (NP_001005222.1) and thoroughly analyze its genomic context on chromosome 11 . The proximity of OR52A4 to other olfactory receptor genes (OR51V1, OR52Z1, OR51A1P, OR52A1, OR52A5) necessitates careful primer design to ensure specificity . Sequence alignment of these related genes can identify unique regions within OR52A4 suitable for targeted amplification.

For detection of the 118 kb deletion that encompasses OR52A4 in β-thalassemia patients, a multiplex PCR approach is recommended . This strategy should include primers that target sequences within the potentially deleted region as well as primers flanking the deletion breakpoints, which have been precisely mapped to the intergenic region between the δ and β-globin genes (5' breakpoint) and between OR52A4 and OR52J1P (3' breakpoint) . This design allows simultaneous detection of the presence or absence of the OR52A4 region and amplification across deletion junctions in affected individuals.

Table 1: Recommended PCR Primer Design Strategy for OR52A4 Genotyping

Primer PurposeTarget RegionKey Design ConsiderationsControls
OR52A4 Specific DetectionUnique regions of OR52A4 coding sequenceMust not amplify related ORs; Verify specificity via BLASTInclude CFTR gene amplification as internal control
Deletion Junction DetectionSpans known breakpoints between δ/β-globin genes and OR52A4/OR52J1PPrimers must flank but not be within deleted regionTest on known heterozygous samples
Multiplex Deletion AnalysisMultiple amplicons within and outside deleted regionBalance primer efficiency; Distinguish products by sizeInclude wild-type, heterozygous, and homozygous deletion samples
SNP GenotypingRegions containing OR52A4 polymorphismsConsider amplicon quality score ≥0.5 for reliable results Include sequence-verified control samples

When designing primers for SNP detection within OR52A4, researchers should consider the impact of amplicon quality on genotyping accuracy . Studies have shown that amplicons with quality scores ≥0.5 typically show discordance rates below 0.5%, while lower quality amplicons contribute significantly to genotyping errors . Primer design should therefore prioritize regions that will generate high-quality amplicons, avoiding repetitive elements, extreme GC content, or regions with secondary structure formation potential.

What quality control measures ensure reliable OR52A4 genotyping data?

Implementing comprehensive quality control measures for OR52A4 genotyping is essential for ensuring data reliability and reproducibility . A multi-layered quality control strategy addresses potential sources of error at each stage of the genotyping process.

For SNP genotyping assays, establishing clear quality metrics and thresholds is fundamental . Key parameters include call rate (typically >95% required), cluster separation in intensity plots, and conformity to Hardy-Weinberg equilibrium in reference populations . SNPs failing these criteria should be flagged for further investigation or excluded from analysis. Minor allele frequency (MAF) should also be considered, as SNPs with very low MAF (<5%) in amplicons with quality scores <0.4 have been associated with higher discordance rates in comparative analyses .

Cross-platform validation represents a critical quality control approach . When feasible, a subset of samples should be genotyped using multiple platforms or methods to assess concordance rates . Comparative studies have documented inter-platform discordance rates ranging from 0.5% to 2%, with particular patterns of discrepancy emerging . The most common form of discrepancy (32% of all discrepancies in one analysis) occurs when one platform reports a heterozygote and another reports a homozygote for the reference allele . Understanding these patterns can help identify potential systematic errors in genotyping assays.

Table 2: Common Discrepancy Patterns in OR Gene Region Genotyping

Discrepancy TypeFrequencyPotential CausesMitigation Strategies
Heterozygote vs. Reference Homozygote32% of all discrepancies Allele dropout; Primer site polymorphismsUse multiple primer pairs; Sequence verification
Reference vs. Alternative Homozygote<10% of all discrepancies Sample mix-up; Incorrect strand reportingImplement sample tracking systems; Standardize strand reporting
Polymorphic vs. Monomorphic Calls0.09% of SNPs Low MAF SNPs; Amplicon quality issuesFocus on high-quality amplicons (score ≥0.5); Verify monomorphic SNPs

For deletion detection assays targeting the 118 kb deletion encompassing OR52A4, additional quality control measures are necessary . These should include positive controls representing all possible genotypes (homozygous normal, heterozygous for deletion, homozygous for deletion) and negative (no-template) controls to detect potential contamination . The CFTR gene is commonly used as an internal amplification control to verify DNA quality and PCR performance .

Periodic sequencing validation of a subset of samples provides the gold standard verification of genotyping accuracy . This approach is particularly valuable for resolving ambiguous genotype calls or confirming the identity of rare variants. By implementing these layered quality control measures, researchers can ensure the reliability of OR52A4 genotyping data and strengthen the validity of their research findings.

How can researchers differentiate OR52A4 from other closely related olfactory receptors?

Differentiating OR52A4 from closely related olfactory receptors presents a significant challenge due to sequence similarities among genes in this family, particularly those in the same genomic cluster (OR51V1, OR52Z1, OR51A1P, OR52A1, OR52A5) . Implementing a multi-faceted approach combining sequence analysis, structural features, and expression patterns enables reliable discrimination between these related receptors.

Structural features provide another layer for differentiation . OR52A4, along with OR52Z1, OR52A1, and OR52A5, displays the characteristic seven transmembrane helix architecture with extracellular amino terminus and intracellular carboxy terminus typical of functional olfactory receptors . In contrast, OR51V1 and OR51A1P possess only six transmembrane helices with two extracellular termini, identifying them as pseudogenes . These structural differences can be predicted using algorithms such as TMHMM and verified through epitope mapping or protease protection assays in experimental settings.

Table 3: Distinguishing Features of OR52A4 and Related Olfactory Receptors

ReceptorReference SequenceTMH CountTermini ConfigurationFunctional StatusRelative Brain Expression
OR52A4NP_001005222.17Extracellular N-terminus, Intracellular C-terminusFunctionalModerate (~5x less than OR51V1)
OR52A1NP_036507.27Extracellular N-terminus, Intracellular C-terminusFunctionalModerate (~5x less than OR51V1)
OR52A5NP_001005160.17Extracellular N-terminus, Intracellular C-terminusFunctionalModerate (~5x less than OR51V1)
OR52Z1Predicted from NG_004304.67Extracellular N-terminus, Intracellular C-terminusFunctionalModerate (~5x less than OR51V1)
OR51V1NP_001004760.26Two extracellular terminiPseudogeneHighest (reference level)
OR51A1PPredicted from NG_002199.36Two extracellular terminiPseudogeneLowest (25x less than OR51V1)

Data compiled from reference .

Expression pattern analysis provides additional discriminatory power . Quantitative PCR or RNA-seq data from brain tissue reveals distinct expression profiles among these receptors: OR51V1 shows the highest expression level, OR51A1P the lowest (25-fold less than OR51V1), and OR52A4 along with OR52Z1, OR52A1, and OR52A5 demonstrates intermediate expression approximately 5-fold less than OR51V1 . These expression differences can serve as fingerprints for receptor identification in tissue samples.

For protein-level discrimination in experimental settings, epitope tagging strategies targeting unique regions of OR52A4 enable specific detection through immunological methods . Alternatively, mass spectrometry-based approaches focusing on receptor-specific peptide fragments can provide highly specific identification and quantification.

What experimental protocols optimize functional characterization of OR52A4?

Functional characterization of OR52A4 requires specialized experimental protocols that address the challenges associated with membrane protein analysis while maximizing receptor activity and signal detection . A comprehensive approach combines proper protein handling, appropriate expression systems, and sensitive detection methods.

For experiments using recombinant OR52A4, proper reconstitution is critical for maintaining functional integrity . Initial handling should include brief centrifugation of protein vials to collect material at the container bottom, followed by reconstitution in deionized sterile water to achieve concentrations between 0.1-1.0 mg/mL . For membrane protein studies, incorporation into appropriate lipid environments is essential—options include liposomes, nanodiscs, or detergent micelles optimized for maintaining membrane protein structure. When stored as a reconstituted solution, addition of glycerol to 5-50% final concentration helps maintain stability, with aliquoting into single-use volumes recommended to avoid freeze-thaw damage .

For cellular expression systems, mammalian cells represent the preferred platform given OR52A4's human origin . HEK293 cells provide a well-characterized background with minimal endogenous olfactory receptor expression. To enhance surface expression of OR52A4, which like many olfactory receptors may face trafficking challenges, co-expression with receptor transporting proteins (RTPs) and receptor expression enhancing proteins (REEPs) significantly improves membrane localization. Additionally, fusion with well-expressed membrane proteins such as rhodopsin or addition of N-terminal signal sequences can enhance surface expression.

Table 4: Optimized Protocols for OR52A4 Functional Characterization

ApproachKey Protocol ElementsDetection MethodsControls
Ligand Binding AssaysReconstituted OR52A4 in nanodiscs or detergent micelles; Concentration range 0.1-1.0 mg/mL Surface plasmon resonance; Microscale thermophoresis; Fluorescence-based bindingInclude denatured receptor as negative control
Calcium Mobilization AssaysHEK293 cells with OR52A4 + Gα15/16; Automated liquid handling for compound testingFLIPR calcium dye; Genetically-encoded calcium indicatorsKnown GPCR activators as positive controls
cAMP Accumulation AssaysOR52A4 with Golf co-expression; Phosphodiesterase inhibitors presentHTRF/TR-FRET cAMP detection; Luciferase-based cAMP sensorsForskolin as positive control
Receptor Trafficking StudiesEpitope-tagged OR52A4; Co-expression with RTPs/REEPsConfocal microscopy; Cell-surface biotinylation; Flow cytometryInclude pseudogene OR51V1 as negative control

For ligand screening, high-throughput approaches coupled with sensitive detection methods maximize discovery potential. Initial screens using calcium mobilization assays with OR52A4 expressed in HEK293 cells co-expressing promiscuous G proteins (Gα15/16) enable detection of receptor activation regardless of native G protein coupling preference. Follow-up assays measuring specific pathways (cAMP production via Golf, β-arrestin recruitment) confirm activation through physiologically relevant mechanisms.

To address the challenges of identifying specific ligands for OR52A4, comparative approaches leveraging the natural deletion in β-thalassemia patients offer unique opportunities . Psychophysical testing comparing olfactory perception between individuals homozygous for the 118 kb deletion (lacking OR52A4) and matched controls could identify specific odorants whose detection is impaired in the absence of OR52A4 . These compounds would represent candidate ligands for focused in vitro testing against recombinant OR52A4.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.