Recombinant Human Putative olfactory receptor 52L2 (OR52L2P)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you may use as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage condition, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR52L2P; OR52L2; Putative olfactory receptor 52L2; Olfactory receptor OR11-74
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR52L2P
Target Protein Sequence
MNLDSFFSFLLKSLIMALSNSSWRLPQPSFFLVGIPGLEESQHWIALPLGILYLLALVGN VTILFIIWMDPSLHQSMYLFLSMLAAIDLVVASSTAPKALAVLLVRAQEIGYTVCLIQMF FTHAFSSMESGVLVAMALDRYVAICHPLHHSTILHPGVIGHIGMVVLVRGLLLLIPFLIL LRKLIFCQATIIGHAYCEHMAVVKLACSETTVNRAYGLTVALLVVGLDVLAIGVSYAHIL QAVLKVPGNEARLKAFSTCGSHVCVILVFYIPGMFSFLTHRFGHHVPHHVHVLLAILYRL VPPALNPLVYRVKTQKIHQ
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 14788

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Human Putative Olfactory Receptor 52L2 (OR52L2P)?

Recombinant Human Putative Olfactory Receptor 52L2 (OR52L2P) is a member of the olfactory receptor family, which consists of G protein-coupled receptors involved in olfactory signal transduction. As a putative olfactory receptor, OR52L2P has been identified through genomic analysis but may have limited functional characterization. The full-length human OR52L2P protein spans 319 amino acids and can be produced as a recombinant protein for research applications . The "putative" designation indicates that while the gene has been identified in the human genome, its precise function and ligand specificity remain under investigation. For research purposes, OR52L2P is typically produced using recombinant expression systems to enable functional and structural studies of this receptor.

What expression systems are available for producing OR52L2P recombinant protein?

Multiple expression systems can be utilized for the production of recombinant OR52L2P, each offering distinct advantages depending on research requirements. The primary expression systems include:

Expression SystemAdvantagesConsiderationsApplications
E. coliHigh yield, cost-effective, rapid productionMay lack post-translational modifications, potential inclusion body formationStructural studies, antibody production
Yeast (SMD1168, GS115, X-33)Eukaryotic processing, higher solubilityModerate yield, longer production timeFunctional studies requiring some post-translational modifications
Insect cells (Sf9, Sf21, High Five)Complex eukaryotic processingHigher cost, technical complexityReceptor conformational studies
Mammalian cells (293, 293T, NIH/3T3, COS-7, CHO)Native-like post-translational modificationsHighest cost, lower yield, longest production timeFunctional assays, signaling studies

Selection of the appropriate expression system should be guided by specific research objectives . For structural studies where high protein yield is prioritized over native conformational integrity, prokaryotic systems like E. coli are often preferred. Conversely, for functional studies investigating ligand binding or signal transduction, mammalian expression systems that ensure proper folding and post-translational modifications are recommended despite their higher cost and complexity.

What fusion tags are commonly employed with OR52L2P and how do they impact purification strategies?

Various fusion tags can be incorporated into recombinant OR52L2P to facilitate purification and potentially enhance solubility. Common options include:

Fusion TagSizePurification MethodImpact on ProteinCleavage Options
His TagSmall (6-10 aa)IMAC (Ni-NTA)Minimal structural impactTEV, Factor Xa
FLAG TagSmall (8 aa)Anti-FLAG affinityMinimal impact, detection advantageEnterokinase
MBPLarge (42 kDa)Amylose resinEnhances solubilityFactor Xa, TEV
GSTMedium (26 kDa)Glutathione resinEnhances solubilityThrombin, PreScission
GFPLarge (27 kDa)Visualization aidFolding indicatorVarious sites

What are the optimal strategies for enhancing functional expression of OR52L2P?

Olfactory receptors, including OR52L2P, present significant challenges for functional expression due to their hydrophobic nature and complex folding requirements. Several strategies can be implemented to optimize functional expression:

  • Codon optimization: Adapting the OR52L2P coding sequence to the codon usage bias of the expression host can significantly improve translation efficiency. This approach involves analyzing the host's preferred codons and modifying the gene sequence accordingly while maintaining the amino acid sequence .

  • Membrane-targeting sequences: Incorporation of signal peptides or membrane-targeting sequences can facilitate proper membrane localization. For mammalian expression, the inclusion of a rhodopsin-derived N-terminal sequence has shown improved surface expression for several olfactory receptors.

  • Chemical chaperones: Supplementing the culture medium with compounds such as DMSO (1-2%), sodium butyrate (5-10 mM), or glycerol (10%) can stabilize protein folding and enhance functional expression.

  • Co-expression with accessory proteins: Co-transfection with olfactory-specific accessory proteins like RTP1S, RTP2, REEP1, or Ric-8B has demonstrated enhanced surface expression of several olfactory receptors and might be beneficial for OR52L2P expression.

  • Temperature modulation: Lowering the incubation temperature to 30°C during expression can reduce aggregation and improve folding, particularly in insect and mammalian systems.

These approaches may be used individually or in combination, with optimization required for the specific expression system selected for OR52L2P production.

How can researchers effectively design deorphanization studies for OR52L2P?

Deorphanization—identifying the cognate ligands for an olfactory receptor—represents a critical step in functional characterization of receptors like OR52L2P. A systematic approach involves:

  • High-throughput screening: Utilizing chemical libraries containing diverse odorants at varying concentrations is essential for initial screening. Modern approaches employ automated calcium imaging or cAMP assays in heterologous expression systems .

  • Concentration-dependent assessment: Evaluate OR52L2P responses across a concentration gradient (typically 10^-9 to 10^-3 M) to generate dose-response curves, as olfactory perception is highly dependent on odorant concentration .

  • Stereochemical considerations: Test enantiomeric pairs separately, as certain ORs show differential responses to stereoisomers. The M2OR database highlights the importance of stereochemistry in OR-ligand interactions .

  • Functional assay selection: Multiple assay platforms should be considered:

    Assay TypeMeasurementAdvantagesLimitations
    Calcium imagingIntracellular Ca²⁺ fluxVisual, spatial informationPotential false negatives
    cAMP assaysSecond messenger levelsQuantitative, sensitiveNo spatial information
    BRET/FRETProtein conformational changesReal-time kineticsComplex setup
    ElectrophysiologyMembrane currentDirect measurementLow throughput
  • Validation strategies: Confirming initial hits through secondary assays, structure-activity relationship studies, and comparing responses in different expression systems enhances confidence in identified ligands.

  • Bioinformatic prediction: Leveraging comparative sequence analysis with previously deorphanized receptors can guide ligand prediction, particularly focusing on OR52 family members with known ligand specificity.

What challenges arise in distinguishing between functional activity and background in OR52L2P studies?

Discriminating genuine OR52L2P activity from experimental artifacts presents a significant challenge in olfactory receptor research. Several methodological approaches can address this issue:

  • Appropriate controls: Including mock-transfected cells, cells expressing unrelated ORs, and cells expressing known functional ORs as comparative controls is essential for establishing baseline responses and positive activation thresholds.

  • Signal normalization: Normalizing responses to established standards (e.g., forskolin for cAMP-dependent pathways) allows for comparison across experiments and reduces variability from expression level differences.

  • Reporter system selection: For functional studies, selecting an appropriate reporter system is crucial:

    Reporter SystemDetection MethodSensitivityBackground Concerns
    GFPFluorescenceModerateAutofluorescence
    LuciferaseLuminescenceHighLow background
    β-lactamaseFRET-basedVery highSubstrate stability
    GloSensorLuminescenceHighTemperature sensitive
  • Statistical validation: Implementing robust statistical approaches to distinguish signal from noise, including multiple technical and biological replicates, appropriate statistical tests, and defined thresholds for activation (typically >2-3× baseline).

  • Dose-dependent confirmation: Verifying that responses show characteristic dose-dependency with EC50 values in physiologically relevant ranges helps confirm functional activity .

  • Molecular verification: Using receptor mutations in predicted binding sites to demonstrate specificity of ligand interactions provides strong evidence for genuine receptor-mediated responses.

How can OR52L2P be utilized in genomic stability research?

While OR52L2P's primary function relates to olfactory signaling, recent findings in genomic stability research suggest potential broader applications. Transcription-replication conflicts (TRCs) and R-loop formation represent significant sources of genomic instability. Research approaches utilizing OR52L2P in this context might include:

  • Transcriptional regulation analysis: Investigating whether OR52L2P expression leads to R-loop formation at its genomic locus, particularly given the often monoallelic expression pattern of olfactory receptors.

  • RAD52 interaction studies: Examining whether genomic regions containing OR52L2P are protected by RAD52-mediated mechanisms against transcription-replication conflicts .

  • Expression system optimization: When expressing OR52L2P recombinantly, considering potential genomic instability caused by high-level expression of membrane proteins, which might be mitigated through RAD52 co-expression .

  • Pseudogene analysis: As a putative receptor (indicated by the "P" designation), investigating whether OR52L2P exhibits characteristics of pseudogenization related to genomic instability events.

The study of RAD52's role in preventing replication-transcription collisions could inform better expression strategies for challenging proteins like OR52L2P, potentially improving recombinant production yields through reduced genomic stress .

What structural analysis techniques are most appropriate for OR52L2P characterization?

Due to the inherent challenges of membrane protein structural biology, a multi-faceted approach is recommended for OR52L2P structural characterization:

  • Computational modeling: Homology modeling based on other resolved GPCR structures provides initial structural insights. Models should incorporate:

    • Template selection from closely related ORs or other class A GPCRs

    • Transmembrane domain prediction and alignment

    • Ligand docking simulations to predict binding pockets

  • Limited proteolysis: This technique can provide information about domain organization and stability by identifying protease-resistant core regions versus flexible segments.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This approach can map solvent-accessible regions and conformational changes upon ligand binding without requiring crystallization.

  • Cryo-electron microscopy: Recent advances have made this technique viable for membrane proteins like ORs, particularly when stabilized through antibody fragments or nanobodies.

  • Solid-state NMR: This method can provide atomic-level information about specific receptor regions, particularly when selectively labeled.

  • Cross-linking mass spectrometry: Chemical cross-linking followed by mass spectrometry analysis can identify proximity relationships between amino acid residues, contributing to structural model validation.

The combination of these approaches, rather than relying on a single method, provides complementary structural information that can overcome the limitations inherent to each individual technique.

How might OR52L2P research contribute to understanding olfactory coding principles?

OR52L2P research can advance our understanding of olfactory coding through several research directions:

  • Receptor tuning breadth analysis: Determining whether OR52L2P exhibits narrow or broad tuning properties through systematic ligand screening helps elucidate how the olfactory system encodes odor identity and intensity.

  • Concentration-dependent receptor activation: Investigating how OR52L2P responds across concentration gradients provides insights into intensity coding mechanisms. Olfactory perception significantly depends on odorant concentration, with different concentrations potentially activating distinct receptor subsets .

  • Combinatorial coding contributions: By determining OR52L2P's activation profile alongside other ORs, researchers can build combinatorial coding models that explain how complex odor mixtures are perceived.

  • Evolutionary analysis: Comparing OR52L2P with orthologous receptors across species can reveal evolutionary adaptations in olfactory receptor repertoires and their functional significance.

  • Signaling pathway characterization: Investigating whether OR52L2P couples preferentially to specific G-protein subtypes or utilizes alternative signaling pathways contributes to understanding signal amplification in the olfactory system.

  • Receptor trafficking and regulation: Studying the mechanisms controlling OR52L2P expression, membrane targeting, and internalization provides insights into olfactory system plasticity and adaptation.

What bioinformatic approaches are most effective for analyzing OR52L2P in the context of the olfactory receptor family?

Comprehensive bioinformatic analysis of OR52L2P requires multi-level computational approaches:

  • Phylogenetic analysis: Positioning OR52L2P within the evolutionary context of the OR family through:

    • Multiple sequence alignment of OR52L2P with other olfactory receptors

    • Construction of phylogenetic trees using maximum likelihood or Bayesian methods

    • Identification of conserved motifs specific to OR52 subfamily members

  • Structural prediction refinement:

    • Integration of evolutionary conservation data to improve homology models

    • Identification of putative ligand-binding residues through conservation analysis

    • Molecular dynamics simulations to assess stability of predicted structures

  • Transcriptomic data integration:

    • Analysis of OR52L2P expression patterns across olfactory epithelia

    • Co-expression network analysis to identify functionally related genes

    • Single-cell RNA sequencing data integration to understand cellular context

  • Comparative genomics:

    • Synteny analysis to identify genomic context conservation

    • Identification of regulatory elements through comparative genomics

    • Analysis of selection pressure (dN/dS ratios) to identify functionally important residues

  • Ligand prediction through machine learning:

    • Training models on known OR-ligand pairs from databases like M2OR

    • Incorporating physicochemical properties of known ligands

    • Virtual screening of compound libraries for potential OR52L2P ligands

These approaches can be implemented using R-based data analysis tools with optimized data.table functions for handling large datasets efficiently .

How can researchers integrate OR52L2P functional data with broader olfactory system models?

Integrating OR52L2P data into system-level olfactory models requires methodological approaches that bridge molecular and perceptual levels:

  • Multi-level data integration framework:

    Data LevelMetricsIntegration ApproachAnalytical Tools
    MolecularBinding affinity, EC50Structure-activity relationshipsCheminformatics, QSAR
    CellularActivation patterns, signaling dynamicsSignal transduction modelingDifferential equations
    Neural circuitGlomerular activation, lateral inhibitionNeural network modelsGraph theory, connectomics
    PerceptualOdor quality, intensity, valencePsychophysical correlationsDimensionality reduction
  • In silico modeling pipeline:

    • Parameter extraction from experimental OR52L2P data

    • Integration into computational models of olfactory bulb processing

    • Simulation of perceptual outcomes based on receptor activation patterns

    • Validation through comparison with psychophysical data

  • Database integration: Utilizing specialized repositories like M2OR to place OR52L2P findings in context with other receptor-ligand pairs, enhancing comparative analysis opportunities .

  • Network analysis approaches: Implementing graph theoretical methods to position OR52L2P within the combinatorial receptor activation network, identifying its contribution to specific odor percepts.

  • Machine learning applications: Developing predictive models that can translate receptor activation patterns (including OR52L2P) into predicted perceptual outcomes, which can then be tested experimentally.

These integration strategies enable researchers to connect molecular findings about OR52L2P to higher-level olfactory system functions and ultimately to perceptual phenomena.

What emerging technologies might advance OR52L2P functional characterization?

Several cutting-edge technologies hold promise for enhancing OR52L2P research:

  • CRISPR-based approaches:

    • Precise genome editing to create reporter knock-ins at the endogenous OR52L2P locus

    • CRISPRa/CRISPRi systems for controlled modulation of OR52L2P expression

    • Base editing for systematic mutagenesis to identify critical functional residues

  • Microfluidic-based screening platforms:

    • High-throughput analysis of OR52L2P responses to compound libraries

    • Concentration gradient generation for automated dose-response profiling

    • Single-cell encapsulation for clonal analysis of OR52L2P variants

  • Advanced imaging technologies:

    • Super-resolution microscopy to visualize OR52L2P trafficking and localization

    • Fluorescent biosensors to monitor real-time conformational changes

    • Optogenetic tools to control OR52L2P signaling with spatiotemporal precision

  • Artificial intelligence integration:

    • Deep learning approaches for predicting OR52L2P-ligand interactions

    • Natural language processing of scientific literature for hypothesis generation

    • Automated experimental design optimization

  • Organoid and synthetic biology approaches:

    • Olfactory epithelium organoids expressing OR52L2P in native-like cellular environments

    • Synthetic cell systems reconstituting minimal OR52L2P signaling components

    • Cell-free expression systems for high-yield production of functional receptor

These technologies, particularly when used in complementary combinations, may overcome current limitations in OR52L2P research and accelerate functional characterization efforts.

How might OR52L2P research contribute to understanding olfactory system disorders?

OR52L2P research has potential implications for understanding and addressing olfactory dysfunction:

  • Anosmia and hyposmia mechanisms: Investigating whether genetic variations in OR52L2P contribute to specific olfactory deficits, particularly for odors that might preferentially activate this receptor.

  • Aging-related olfactory decline: Examining age-dependent changes in OR52L2P expression or function that might contribute to the well-documented decline in olfactory sensitivity with aging.

  • Post-viral olfactory dysfunction: Exploring potential mechanisms by which viral infections (including SARS-CoV-2) might impact OR52L2P expression or function, contributing to post-viral olfactory disorders.

  • Neurodegenerative disease biomarkers: Investigating whether altered OR52L2P function correlates with early stages of neurodegenerative conditions like Parkinson's or Alzheimer's disease, which often feature olfactory dysfunction as an early symptom.

  • Personalized medicine applications: Analyzing individual variations in OR52L2P to understand differential olfactory perception and potentially customize odorant-based interventions for specific patient populations.

Research focused on OR52L2P function in these contexts could contribute to diagnostic tools, therapeutic strategies, or fundamental understanding of olfactory system pathologies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.