Recombinant Human Putative olfactory receptor 7A2 (OR7A2P)

Shipped with Ice Packs
In Stock

Description

Expression and Production

Commercial vendors produce OR7A2P using multiple platforms:

VendorCatalog #Expression SystemTag InformationApplications
MyBioSource MBS7096204E. coli/yeast/mammalianN-terminal and optional C-terminal tagsResearch (non-diagnostic)
Cusabio CSB-CF847715HUE. coliUnspecifiedBiochemical assays

Lyophilized or liquid formulations are available, with storage recommendations at -20°C or -80°C for long-term stability .

3.1. Olfactory Receptor Family Insights

OR7A2P is part of the largest GPCR family, with ~400 functional receptors and ~600 pseudogenes in humans . Despite its pseudogene status, recombinant OR7A2P is studied for:

  • Ectopic Expression: Broad OR expression in non-olfactory tissues (e.g., testis, kidney) , suggesting roles beyond smell.

  • Ligand Screening: Heterologous systems (e.g., HEK293 cells, Xenopus oocytes) enable calcium imaging and electrophysiology to identify ligands .

3.2. Comparative Functional Studies

While OR7A2P-specific ligands remain unidentified, related ORs exhibit ligand-specific activation:

  • OR17-40: Activated by helional and heliotropylacetone .

  • OR51E1/2: Responds to β-ionone and nonanoic acid .

  • OR6B2: Localized to sperm flagella, influencing chemotaxis .

These methodologies provide a framework for OR7A2P deorphanization, though no published data confirm its activation .

Challenges and Future Directions

  • Pseudogene Status: OR7A2P’s functionality requires validation, as pseudogenes may retain partial activity .

  • Ligand Identification: High-throughput screens using calcium imaging or cAMP assays are needed .

  • Structural Analysis: Molecular modeling could resolve its ligand-binding pocket and transmembrane topology .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
OR7A2P; OR7A2; OR7A7; Putative olfactory receptor 7A2; Putative olfactory receptor 7A7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR7A2P
Target Protein Sequence
MVKAGNETQISEFLLLGFSEKQELQPFLFGLFLSMYLVTVLGNLLIILAAISDSCLHTPM YFFLSNLSFVDICFASTMVPKMLVNIQTQSKVITYAGCITQMCFFVLFIVLDSLLLTVMA YDQFVAICHPLHYTVIMSPQLCGLLVLVSWIMSVLNSMLQSLVTLQLSFCTDLEIPHFFC ELNEMIHLACSDTFVNNMVMHFAAVLLDGGPLVGILYSYCRIVSSIRAISSTQGKYKALS TCASHLSVVSIFYGTGLGVYLSSTMTQNLHSTAVASVMYTVVTPMLNPFIYSLRNKDIKG ALTQFFRGKQ
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 8370

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR7A2P and what is its function?

OR7A2P (Putative olfactory receptor 7A2 or Putative olfactory receptor 7A7) is an odorant receptor belonging to the family 7, subfamily A of human olfactory receptors. Its primary function is odorant detection, contributing to the human olfactory system's ability to discriminate between thousands of different odors. The protein functions as a sensory receptor that interacts with odorant molecules in the nasal epithelium and initiates signaling cascades that ultimately lead to odor perception .

How is recombinant OR7A2P typically expressed and purified?

Recombinant OR7A2P is typically expressed in mammalian expression systems, particularly HEK-293 cells, to ensure proper folding and post-translational modifications. For purification and detection purposes, the protein is often tagged with epitopes such as His-tag. The purification process generally involves:

  • Transfection of expression vectors containing the OR7A2P sequence into HEK-293 cells

  • Culture and expression induction

  • Cell lysis under conditions that preserve protein structure

  • Affinity chromatography using the His-tag

  • Quality assessment via SDS-PAGE, Western Blot, and analytical SEC (HPLC)

The purified protein typically achieves >70-80% purity and can be maintained in appropriate buffer conditions for downstream applications .

What experimental design approaches are most appropriate for studying OR7A2P function?

When studying OR7A2P function, true experimental designs with proper controls are essential. A robust experimental design should include:

  • Control vs. Experimental Groups: Establish clear control groups (cells without OR7A2P expression) and experimental groups (cells expressing OR7A2P) with random assignment to eliminate bias.

  • Variable Manipulation: Systematically manipulate independent variables such as ligand concentration, exposure time, or competing ligands.

  • Random Distribution: Ensure random distribution of variables to control for extraneous factors that might influence receptor activation.

  • Defined Endpoints: Establish clear dependent variables (e.g., calcium influx, cAMP production, reporter gene expression) to measure receptor activation .

For optimal results, factorial designs that vary multiple parameters simultaneously can identify interaction effects between variables that might affect OR7A2P activity. This approach is particularly valuable when testing multiple potential ligands across concentration ranges .

How should researchers address extraneous variables when designing OR7A2P experiments?

Controlling extraneous variables is crucial for reliable OR7A2P research. Key strategies include:

  • Cell Line Consistency: Maintain consistent passage numbers of expression cell lines, as receptor expression can vary with cellular aging.

  • Expression Verification: Verify sustainable expression of OR7A2P, ensuring levels remain within 2× of the initially measured expression after establishment.

  • Environmental Control: Standardize temperature, humidity, and CO2 levels during cell culture and assays.

  • Reagent Quality Control: Use the same lot numbers for critical reagents throughout a study when possible.

  • Blinding Procedures: Implement blinding procedures for data collection and analysis to prevent unconscious bias.

  • Time-Based Controls: Include time-matched controls to account for any temporal drift in cellular responses .

Document all potential confounding variables systematically using a standardized table format similar to NIH data tables for reproducibility and comprehensive reporting .

What methods are available for identifying OR7A2P ligand interactions?

Several methodologies can be employed to identify and characterize ligand interactions with OR7A2P:

  • Reporter Gene Assays: Utilize inducible reporter systems where OR7A2P activation triggers expression of easily detectable reporters such as luciferase or fluorescent proteins. This approach allows for high-throughput screening of potential ligands.

  • Calcium Imaging: Since olfactory receptors typically signal through Gαolf and elevate intracellular calcium, calcium-sensitive dyes or genetically encoded calcium indicators can provide real-time readout of receptor activation.

  • Barcoded Reporter Systems: Implement systems where the reporter contains a unique barcode specific to OR7A2P that can be identified through sequencing. This approach is particularly valuable for multiplexed screening of multiple receptors simultaneously .

  • Electrophysiology: Patch-clamp recordings in heterologous expression systems can provide detailed functional characterization of OR7A2P responses.

  • Molecular Dynamics Simulations: Computational approaches can predict ligand binding sites and interaction energies to complement experimental data.

For high-confidence results, researchers should employ at least two orthogonal methods to confirm ligand-receptor interactions .

How can high-throughput screening be optimized for OR7A2P ligand discovery?

High-throughput screening for OR7A2P ligands can be optimized through:

  • Stable Cell Line Development: Create cell lines with sustainable OR7A2P expression rather than relying on transient transfection, which introduces variability.

  • Multiplexed Assay Systems: Implement barcoded reporter systems where expression of the reporter is dependent on receptor activation, and the reporter contains an index region unique to OR7A2P.

  • Multi-Concentration Testing: Test compounds at multiple concentrations in parallel to generate dose-response curves in a single experiment.

  • Automation Integration: Utilize automated liquid handling and data collection systems to increase throughput and reduce human error.

  • Data Analysis Pipelines: Develop robust data analysis pipelines that can process large datasets and identify hits based on statistical significance.

For optimal efficiency, consider pooled screening approaches where multiple ligands are tested simultaneously, followed by deconvolution of positive hits .

What are the most significant challenges in studying OR7A2P and how can they be addressed?

Key challenges in OR7A2P research include:

  • Functional Expression: Like many olfactory receptors, OR7A2P may exhibit poor functional expression in heterologous systems. This can be addressed by:

    • Co-expression with receptor trafficking proteins (RTPs) and olfactory G proteins

    • Codon optimization of the OR7A2P sequence

    • Use of specialized expression vectors with strong promoters

    • Creation of fusion constructs with well-expressed membrane proteins

  • Ligand Identification: The chemical space of potential ligands is vast. Strategies to address this include:

    • Focused libraries based on structural similarity to known olfactory ligands

    • Fragment-based screening approaches

    • Computational prediction of ligands based on receptor structure

    • Chemoinformatic approaches to identify scaffolds with higher probability of receptor interaction

  • Assay Sensitivity: Due to potentially low surface expression, assay sensitivity can be limiting. Solutions include:

    • Signal amplification strategies

    • Use of more sensitive detection technologies

    • Designing assays with lower background and higher signal-to-noise ratios

How should dose-response data for OR7A2P ligands be analyzed?

Dose-response data for OR7A2P requires rigorous analysis approaches:

  • Curve Fitting: Apply appropriate mathematical models (four-parameter logistic regression is standard) to fit dose-response curves and extract key parameters:

    • EC50 (half-maximal effective concentration)

    • Hill coefficient (slope)

    • Maximum response (Emax)

    • Minimum response (baseline)

  • Statistical Validation: Perform statistical tests to:

    • Compare EC50 values between different ligands

    • Assess goodness-of-fit for curve models

    • Evaluate confidence intervals for all parameters

  • Normalization Strategies: Consider different normalization approaches:

    • Percent of maximum response to a reference ligand

    • Z-score normalization across plates

    • Signal-to-baseline ratio

  • Visualization: Present data in standardized formats showing both fitted curves and individual data points with error bars representing standard deviation or standard error .

What controls are essential for validating OR7A2P research findings?

Validation of OR7A2P research requires comprehensive controls:

  • Negative Controls:

    • Empty vector-transfected cells

    • Untransfected cells

    • Known non-ligands structurally similar to test compounds

    • Vehicle controls (solvent only)

  • Positive Controls:

    • Cells expressing well-characterized olfactory receptors with known ligands

    • If available, known OR7A2P ligands at standardized concentrations

  • System Validation Controls:

    • Reporter system functionality tests using constitutively active constructs

    • Tests of general cell viability and assay performance

    • Verification of receptor expression using antibodies or fluorescent tags

  • Specificity Controls:

    • Testing of ligands on other olfactory receptors to establish selectivity profiles

    • Competitive binding assays with unlabeled ligands

    • Mutational analysis of predicted binding sites

How can OR7A2P research contribute to understanding the human olfactory system?

OR7A2P research contributes to our understanding of human olfaction through:

  • Decoding the Olfactory Code: By identifying ligands for OR7A2P and comparing with other olfactory receptors, researchers can help decipher how combinatorial receptor activation patterns encode odor perception.

  • Receptor-Ligand Relationship Models: Data from OR7A2P binding studies can inform structure-activity relationship models that predict odor perception based on molecular features.

  • Evolutionary Insights: Comparative analysis of OR7A2P with homologs in other species can reveal evolutionary adaptations in olfactory perception.

  • Sensory Neuroscience Applications: OR7A2P activation patterns can be correlated with psychophysical data to bridge molecular mechanisms with perceptual outcomes.

The methodical mapping of OR7A2P to its chemical ligands contributes to the broader effort of understanding how approximately 400 functional human olfactory receptors can discriminate thousands of odors .

What approaches are available for studying OR7A2P in more native-like contexts?

To study OR7A2P in more physiologically relevant contexts:

  • Organoid Models: Develop olfactory epithelium organoids that express OR7A2P in a tissue-like environment.

  • Primary Cell Cultures: Isolate and culture primary olfactory sensory neurons expressing OR7A2P.

  • Genetic Modification in Animal Models: Use CRISPR/Cas9 to introduce human OR7A2P into model organisms for in vivo studies.

  • Microfluidic Systems: Develop microfluidic platforms that allow controlled odorant delivery to cells expressing OR7A2P.

  • Co-culture Systems: Establish co-cultures of OR7A2P-expressing cells with supporting cells that provide the native microenvironment.

These approaches can provide insights into receptor function that may not be apparent in conventional heterologous expression systems .

What are common pitfalls in OR7A2P expression systems and how can they be avoided?

Common problems and solutions in OR7A2P expression include:

  • Poor Surface Expression:

    • Co-express with receptor trafficking proteins (RTPs)

    • Optimize signal sequence

    • Consider fusion constructs with rhodopsin or other well-expressed GPCRs

    • Use specialized mammalian expression systems like HEK-293 derivatives

  • Receptor Misfolding:

    • Optimize culture temperature (often 30-33°C works better than 37°C)

    • Add chemical chaperones to growth media

    • Consider directed evolution approaches to identify better-expressed variants

  • Inconsistent Reporter Response:

    • Validate reporter construct independently

    • Ensure appropriate coupling proteins are expressed

    • Control for cell density and passage number

    • Standardize assay conditions rigorously

How can researchers address non-specific responses when screening for OR7A2P ligands?

To minimize non-specific responses:

  • Stringent Controls: Always include cells expressing the reporter system but lacking OR7A2P.

  • Counter-Screening: Test hits on cells expressing unrelated receptors to identify compounds that may activate signaling pathways independently of receptor binding.

  • Dose-Response Confirmation: Confirm all hits with full dose-response curves, as true ligands typically show concentration-dependent effects.

  • Orthogonal Assays: Validate hits using different assay technologies that measure distinct aspects of receptor activation.

  • Structural Derivatives: Test structural analogs of hit compounds to establish structure-activity relationships consistent with specific receptor binding.

  • Receptor Mutagenesis: Introduce mutations in predicted binding sites to confirm the mechanism of ligand recognition .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.