Recombinant Human Putative P2Y purinoceptor 10 (P2RY10)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Putative P2Y Purinoceptor 10 (P2RY10)

Recombinant Human Putative P2Y Purinoceptor 10, commonly referred to as P2RY10, is a G-protein-coupled receptor (GPCR) that plays a significant role in various cellular processes, including immune responses and cellular signaling. It is encoded by the P2RY10 gene in humans and is part of the purinergic receptor family, which responds to purine nucleotides like adenosine and ATP . Despite being considered an orphan receptor due to its unknown endogenous ligand, recent studies have identified lysophosphatidylserine (LysoPS) as a potential ligand for P2RY10 .

Structure and Function

P2RY10 is a transmembrane protein with seven transmembrane domains, typical of GPCRs. It has a molecular weight of approximately 38.8 kDa and is composed of 339 amino acids . The activation of P2RY10 leads to the mobilization of intracellular calcium stores and the activation of protein kinases, which are crucial for signaling pathways involved in cell migration and differentiation .

Characteristics of P2RY10Description
Gene NameP2RY10
Protein NamePutative P2Y Purinoceptor 10
Length (aa)339
Transmembrane Times7
Molecular Weight38.8 kDa
LigandsLysoPS, ATP

Expression and Localization

P2RY10 is expressed in various cell types, including immune cells such as T cells and eosinophils. In T cells, it is involved in chemokine-induced migration and is upregulated during certain immune responses . In eosinophils, P2RY10 mediates degranulation in response to LysoPS, suggesting its role in allergic reactions .

Cell TypesExpression LevelFunction
CD4 T CellsHighChemokine-induced migration
EosinophilsHighDegranulation in response to LysoPS

Research Findings

Recent studies have highlighted the role of P2RY10 in immune diseases. For instance, in mice lacking P2RY10 in CD4 T cells, the severity of autoimmune diseases like experimental autoimmune encephalomyelitis (EAE) is reduced, indicating its involvement in T cell-mediated inflammation . Additionally, P2RY10 knockdown in human CD4 T cells impairs chemokine-induced migration, suggesting a conserved function across species .

Disease ModelP2RY10 FunctionOutcome
EAE (Mice)Facilitates T cell migrationReduced disease severity
Human CD4 T CellsMediates chemokine-induced migrationImpaired migration upon knockdown

Therapeutic Potential

Given its role in immune responses and eosinophil degranulation, P2RY10 is a potential therapeutic target for treating immune-related disorders and allergic diseases. Targeting P2RY10 could help modulate immune cell migration and activation, offering new avenues for disease management .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill them based on availability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments default to standard blue ice packs. If you require dry ice packaging, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize their development based on feasibility.
Synonyms
P2RY10; Putative P2Y purinoceptor 10; P2Y10; P2Y-like receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-339
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MANLDKYTETFKMGSNSTSTAEIYCNVTNVKFQYSLYATTYILIFIPGLLANSAALWVLC RFISKKNKAIIFMINLSVADLAHVLSLPLRIYYYISHHWPFQRALCLLCFYLKYLNMYAS ICFLTCISLQRCFFLLKPFRARDWKRRYDVGISAAIWIVVGTACLPFPILRSTDLNNNKS CFADLGYKQMNAVALVGMITVAELAGFVIPVIIIAWCTWKTTISLRQPPMAFQGISERQK ALRMVFMCAAVFFICFTPYHINFIFYTMVKETIISSCPVVRIALYFHPFCLCLASLCCLL DPILYYFMASEFRDQLSRHGSSVTRSRLMSKESGSSMIG
Uniprot No.

Target Background

Function
Putative receptor for purines coupled to G-proteins.
Gene References Into Functions
  1. The P2Y(10) receptor is the first receptor identified as a dual lysophospholipid receptor. PMID: 18466763
Database Links

HGNC: 19906

OMIM: 300529

KEGG: hsa:27334

STRING: 9606.ENSP00000171757

UniGene: Hs.296433

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Weakly expressed in blood leukocytes.

Q&A

What is the official status of P2RY10 as a receptor?

Despite extensive research, P2RY10 is still officially classified as an orphan G-protein coupled receptor by the International Union of Basic & Clinical Pharmacology. This designation indicates that its endogenous ligand has not been unanimously confirmed, though several potential ligands have been identified in experimental settings, including lysophosphatidylserine (LysoPS) and adenosine triphosphate (ATP) .

What are the primary physiological functions of P2RY10?

P2RY10 plays a significant role in immune cell function, particularly in CD4 T cell migration. Research has demonstrated that P2RY10 facilitates chemokine-induced migration of CD4 T cells through an auto-/paracrine feedback loop involving adenine nucleotides and lysophosphatidylserine. This function is particularly important in inflammatory responses and has been implicated in neuroinflammatory conditions like experimental autoimmune encephalomyelitis .

How does P2RY10 contribute to CD4 T cell migration at the molecular level?

P2RY10 mediates CD4 T cell migration through a complex signaling cascade. Upon chemokine exposure, CD4 T cells release the putative P2Y10 ligands lysophosphatidylserine and ATP, which then act in an autocrine/paracrine fashion to activate P2Y10. This activation leads to RhoA activation, a critical step for cell polarization and migration. In P2Y10-deficient CD4 T cells, chemokine-induced RhoA activation, polarization, and migration are significantly reduced, confirming its central role in this process .

What is the relationship between P2RY10 and G-protein signaling?

P2RY10 appears to couple to multiple G-protein families with distinct downstream effects. Research suggests coupling to the G12/13 family G-proteins, which are known to regulate RhoA activation. Additionally, ATP stimulation induces inositol monophosphate (IP1) production in control CD4 cells but not in P2Y10-deficient cells, suggesting potential coupling to Gq/11 proteins. Interestingly, cAMP levels are not altered by ATP treatment in either control or knockout cells, indicating P2RY10 does not significantly couple to Gs or Gi/o proteins in CD4 T cells .

What experimental evidence supports LysoPS and ATP as ligands for P2RY10?

The identification of LysoPS and ATP as potential P2RY10 ligands is supported by functional assays measuring RhoA activation. When naïve CD4 T cells from control and P2RY10-knockout mice were treated with various potential ligands, LysoPS species (18:0 and 18:1) enhanced RhoA activation in control cells, but this effect was abrogated in P2RY10-deficient cells. Similarly, ATP induced RhoA activation in a P2RY10-dependent manner. In contrast, while S1P and LPA also induced RhoA activation, these effects were maintained in P2RY10-deficient cells, indicating they act through different receptors .

How has the role of P2RY10 been studied in animal models of inflammatory disease?

Researchers have employed CRISPR/Cas9 genome editing to generate mice carrying a floxed P2ry10 allele and bred them with CD4Cre mice to create CD4 T cell-specific P2RY10 knockout models. These CD4-P2Y10-KO mice exhibited reduced severity of experimental autoimmune encephalomyelitis (EAE) and cutaneous contact hypersensitivity compared to control littermates. Histological analysis revealed reduced demyelination and decreased numbers of spinal cord-infiltrating CD4 T cells in knockout mice, demonstrating the importance of P2RY10 in T cell-mediated inflammatory diseases .

What is known about P2RY10's relevance in human inflammatory conditions?

The P2RY10 pathway appears to be conserved in human T cells, suggesting similar functions across species. siRNA-mediated knockdown of P2RY10 in primary human CD4 T cells resulted in impaired SDF-1α-induced migration. Importantly, this effect was observed in CD4 T cells isolated from both healthy donors and multiple sclerosis (MS) patients, indicating the receptor's potential relevance in human autoimmune conditions. These findings suggest P2RY10 could be a therapeutic target for inflammatory diseases characterized by pathological T cell infiltration .

What expression systems are suitable for producing recombinant P2RY10?

Recombinant P2RY10 can be successfully expressed in prokaryotic systems such as E. coli, as demonstrated by commercially available products . For research applications requiring fully functional protein with proper post-translational modifications, eukaryotic expression systems (mammalian, insect, or yeast cells) may be preferable, though this will depend on the specific experimental requirements and whether particular post-translational modifications are crucial for the aspects being studied.

What are the optimal storage and handling conditions for recombinant P2RY10 protein?

Recombinant P2RY10 protein is typically supplied as a lyophilized powder and should be stored at -20°C/-80°C upon receipt. For working with the protein, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is recommended. Addition of glycerol (final concentration 5-50%) helps maintain stability during storage, and the resulting solution should be aliquoted to avoid repeated freeze-thaw cycles, which can degrade the protein. Working aliquots can be stored at 4°C for up to one week .

What validation methods should be used to confirm recombinant P2RY10 activity?

Validation of recombinant P2RY10 activity can include:

  • SDS-PAGE analysis to confirm purity and correct molecular weight

  • Functional assays measuring RhoA activation in response to known ligands

  • IP1 production assays to assess coupling to Gq/11 signaling pathways

  • Cell migration assays to evaluate biological relevance in chemotaxis models

  • Binding assays with putative ligands like LysoPS and ATP

For comprehensive validation, comparing the activity of recombinant protein with endogenous P2RY10 in relevant cell types (e.g., CD4 T cells) can provide important contextual information about physiological function.

What are the key considerations when designing experiments to investigate P2RY10 function in T cells?

When designing experiments to study P2RY10 function in T cells, researchers should consider:

  • Cell type selection: Naïve vs. activated CD4 T cells show different P2RY10 expression levels

  • Genetic approaches: CRISPR-Cas9 for knockout studies or siRNA for transient knockdown

  • Pharmacological tools: Testing multiple putative ligands (LysoPS species, ATP) and potential inhibitors

  • Readout selection: RhoA activation, cell polarization, and migration are key functional endpoints

  • Controls: Including related GPCRs (e.g., GPR34, GPR174, P2Y10b) to assess specificity

  • Species considerations: Validating findings across mouse and human systems

A comprehensive experimental design might include parallel genetic and pharmacological approaches, with multiple functional readouts to capture different aspects of P2RY10 signaling.

How can researchers address the challenges of studying an orphan receptor like P2RY10?

Studying orphan receptors presents unique challenges that require specialized approaches:

  • Unbiased ligand screening: Test diverse compound libraries to identify potential ligands

  • Reverse pharmacology: Use cells expressing the receptor to identify activating compounds

  • Comparative analysis: Study P2RY10 alongside related receptors with known ligands

  • Structure-based approaches: Utilize computational modeling to predict ligand binding

  • Genetic tools: Generate knockout models to identify phenotypes that suggest physiological function

  • Tissue expression analysis: Map receptor expression to help identify physiological contexts

For P2RY10 specifically, researchers might focus on CD4 T cells and inflammatory disease models where the receptor has shown functional relevance.

What are the best methods to study the crosstalk between P2RY10 and chemokine receptor signaling?

To investigate the crosstalk between P2RY10 and chemokine receptor signaling, researchers should consider:

  • Sequential stimulation experiments: Priming cells with one stimulus before adding the second

  • Combined genetic models: Using cells deficient in both P2RY10 and specific chemokine receptors

  • Temporal signaling analysis: Monitoring RhoA activation and other signaling events with high temporal resolution

  • Subcellular localization studies: Tracking receptor redistribution during cell migration

  • Extracellular mediator analysis: Measuring release of putative P2RY10 ligands following chemokine stimulation

  • Microfluidic migration assays: Allowing precise control of chemokine gradients and real-time visualization

Since P2RY10 facilitates chemokine-induced migration through an auto-/paracrine loop, special attention should be paid to the timing and spatial organization of signaling events.

How can researchers reconcile conflicting data about P2RY10 ligand specificity?

The ligand specificity of P2RY10 remains controversial, with several proposed ligands including LysoPS and ATP . To reconcile conflicting data, researchers should:

  • Standardize experimental conditions across studies

  • Use multiple assay systems to measure receptor activation

  • Include both positive and negative controls for each potential ligand

  • Test structure-activity relationships with related compounds

  • Compare results across species and cell types

  • Validate findings with both recombinant systems and endogenous receptor settings

  • Consider receptor heteromerization that might affect ligand specificity

It's also important to acknowledge that P2RY10 might be a promiscuous receptor with multiple physiological ligands or that its ligand preference might vary depending on cellular context.

What are the primary technical challenges in measuring P2RY10-dependent RhoA activation?

Measuring P2RY10-dependent RhoA activation presents several technical challenges:

  • Temporal dynamics: RhoA activation is rapid and transient, requiring precise timing

  • Signaling specificity: Multiple GPCRs can activate RhoA through various G proteins

  • Cell type variability: Different cell types have unique baseline RhoA activation levels

  • Assay sensitivity: Detecting subtle changes in activation requires robust methods

  • Background signaling: Endogenous receptors may contribute to baseline activation

  • Reagent quality: Commercial antibodies for active RhoA vary in specificity and sensitivity

To address these challenges, researchers should employ multiple complementary techniques such as pull-down assays for active RhoA, live-cell imaging with FRET-based sensors, and downstream functional readouts like cytoskeletal reorganization.

What emerging technologies could advance P2RY10 research?

Several emerging technologies hold promise for advancing P2RY10 research:

  • Cryo-electron microscopy: To determine the three-dimensional structure of P2RY10

  • Single-cell RNA sequencing: To identify cell populations with high P2RY10 expression

  • CRISPR-based screening: To identify genes that modulate P2RY10 function

  • Optogenetics: To achieve temporal control of P2RY10 activation

  • Advanced imaging techniques: To visualize P2RY10 trafficking and localization during cell migration

  • Organ-on-chip technology: To study P2RY10 function in complex tissue environments

  • AI-driven drug discovery: To identify selective modulators of P2RY10 activity

These technologies could help resolve outstanding questions about P2RY10's structure, ligand specificity, and physiological functions.

What therapeutic potential does targeting P2RY10 hold for inflammatory diseases?

The therapeutic potential of targeting P2RY10 for inflammatory diseases is supported by several lines of evidence:

  • CD4 T cell-specific P2RY10 knockout mice show reduced severity of experimental autoimmune encephalomyelitis and cutaneous contact hypersensitivity

  • P2RY10 is specifically upregulated in activated CD4 T cells and in cells infiltrating inflammatory sites

  • The receptor facilitates chemokine-induced T cell migration, a critical step in inflammatory processes

  • The P2RY10 pathway appears to be conserved between mice and humans

Potential therapeutic approaches could include:

  • Small molecule antagonists to block P2RY10 activation

  • Antibodies targeting the receptor's extracellular domains

  • Inhibitors of downstream signaling components

  • RNA-based therapeutics to reduce P2RY10 expression

Given its specific role in T cell migration rather than activation or differentiation, P2RY10 inhibition might offer targeted immunomodulation with potentially fewer side effects than broader immunosuppressive approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.