Recombinant Human Putative protein dpy-19 homolog 2-like 2 (DPY19L2P2)

Shipped with Ice Packs
In Stock

Description

Recombinant DPY19L2P2 Protein Characteristics

Recombinant DPY19L2P2 is produced using various expression systems and tagged for purification and detection. Key specifications include:

ParameterDetails
Amino Acid Sequence1-376 residues: MADSRRVIIASWYRT...CRLEAWLQHA
Molecular Weight~44.2 kDa (including tags)
Expression SystemsE. coli, insect cells, cell-free protein synthesis (CFPS)
Purification TagsStrep Tag, rho-1D4 Tag, His Tag
Purity>90% (verified via SDS-PAGE, size exclusion chromatography)
ApplicationsELISA, Western blotting, crystallization, structural studies

Comparative Studies

Recombinant DPY19L2P2 is used to:

  • Analyze structural divergence from functional DPY19L2 .

  • Investigate pseudogene transcriptional regulation and potential neofunctionalization .

Technical Uses

  • Antibody Production: Serves as an antigen for generating antibodies targeting DPY19L family proteins .

  • Crystallography: High-purity recombinant protein facilitates 3D structure determination .

Expression Systems and Production

SystemAdvantagesExamples
E. coliCost-effective, high yieldFull-length His-tagged protein
Insect CellsProper post-translational modificationsCrystallization-grade protein
CFPSRapid production, tag flexibilityStrep-tagged variant

Clinical and Evolutionary Relevance

  • Globozoospermia: While DPY19L2 mutations cause this infertility disorder , DPY19L2P2’s lack of function underscores its role as a pseudogene .

  • Gene Relocation: DPY19L2P2’s ancestral locus on chromosome 7 was pseudogenized, while DPY19L2 relocated to chromosome 12 via low-copy repeats (LCRs) .

Challenges and Future Directions

  • Functional Redundancy: Despite homology, DPY19L2P2 shows no compensatory activity for DPY19L2 in knockout models .

  • Transcriptional Activity: Its tissue-specific expression warrants exploration into regulatory roles or non-coding RNA functions .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please contact us in advance for an additional fee.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag preference, please inform us, and we will prioritize developing your specified tag.
Synonyms
DPY19L2P2; Putative C-mannosyltransferase DPY19L2P2; Dpy-19-like protein 2 pseudogene 2; Protein dpy-19 homolog 2-like 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-376
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
DPY19L2P2
Target Protein Sequence
MADSRRVIIASWYRTFMGIVNLFGLETKTCWNVTRIEPLNEVQSCEGLRDPACFYVGVIF ILNGLMMGLFFIYGTYLSGTELGGLITVLCFFFNHGEATCVMWTPPLRESFSYPFLVLQM YVLTLILRTSSNDRRPFIALCLSNVAFMLPWQFAQFILFTQIASLFPMYVVGYIEPSKFQ KIIYMNMISVTLSFILMFGNSMYLSSYYSSSLLMTWAIILKRNEIQKLGVSKLNCWLIQG SAWWCGTIILKFLTSKILGVSDHICLSDLIAAGILRYTDFDTLKYTCSPEFDFMEKATLL IYTKTLLLPVVMVITCFIFKKTVGDISRVLATNVYLRCCLCRCHAYNGKCQAVYTSSHCE SSTLRRCRLEAWLQHA
Uniprot No.

Target Background

Function
Probable C-mannosyltransferase that mediates C-mannosylation of tryptophan residues on target proteins.
Database Links

HGNC: 21764

UniGene: Hs.732579

Protein Families
Dpy-19 family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Fibroblast, lung, lymphoblast, spleen and testis.

Q&A

What is DPY19L2P2 and how does it relate to the functional DPY19L2 gene?

DPY19L2P2 is one of several pseudogenes derived from DPY19L2 through genomic duplication events. It belongs to the DPY19L gene family, which evolved from a single ancestral gene found in invertebrates like C. elegans (DPY-19). In humans, this family includes four functional genes (DPY19L1-4) and multiple pseudogenes that arose through duplication processes .

DPY19L2P2 specifically is located on chromosome 7 within a low copy repeat (LCR) region designated as LCR7D. Unlike functional DPY19L2, DPY19L2P2 contains inactivating mutations, particularly insertions of LTR repeats in exon 3 that introduce premature stop codons, preventing it from producing a functional protein .

What is the evolutionary origin of DPY19L2P2?

DPY19L2P2 emerged through recent primate-specific evolutionary events involving low copy repeats (LCRs). The DPY19L gene family first expanded through ancient duplications that created the four main functional genes found in mammals. More recently in the primate lineage, additional duplications within LCRs resulted in multiple pseudogenes including DPY19L2P2 .

The genomic architecture featuring LCRs facilitated non-allelic homologous recombination (NAHR) events that drove these duplications. This mechanism has been particularly active in the primate lineage, as evidenced by the absence of these pseudogenes in mouse and other non-primate mammals, where only the functional genes are present .

How is DPY19L2P2 structurally different from functional DPY19L2?

While functional DPY19L2 encodes a multipass transmembrane protein with 6-11 transmembrane domains, DPY19L2P2 contains inactivating mutations that disrupt its open reading frame (ORF). Specifically:

These structural differences are characteristic of pseudogenization, where duplicate genes accumulate mutations due to relaxed selection pressure resulting from functional redundancy with the original gene .

What is the genomic location and context of DPY19L2P2?

DPY19L2P2 is located within LCR7D on chromosome 7, one of eight LCRs (LCR7A-H) that contain the DPY19L gene family members and their pseudogenes. These LCRs share high sequence identity (97%) and have been the sites of multiple duplication and pseudogenization events .

The genomic arrangement reveals that while the functional DPY19L2 gene relocated to chromosome 12, its pseudogenes including DPY19L2P2 remain on chromosome 7. This pattern demonstrates the complex genomic rearrangements that have occurred during primate evolution, resulting in both gene relocation and pseudogenization .

What techniques can differentiate between DPY19L2 and its pseudogenes in experimental settings?

Distinguishing between the highly similar sequences of DPY19L2 and its pseudogenes presents significant technical challenges. Effective methodological approaches include:

  • PCR-based discrimination:

    • Design primers targeting unique sequence variations or pseudogene-specific mutations

    • Sequence verification of PCR products is essential as noted in the research where "sequencing the bands from the RT-PCR experiment" helped determine expression patterns

  • Next-generation sequencing approaches:

    • RNA-Seq with computational filtering to distinguish between highly similar transcripts

    • Long-read sequencing technologies that can span distinctive regions

  • Targeted mutation detection:

    • Assays focused on the specific LTR insertions in exon 3 of DPY19L2P2

    • Breakpoint-spanning PCR to identify pseudogene-specific genomic contexts

These methods must account for the high sequence identity between family members, which can lead to non-specific amplification as noted in the research where "we were unable to specifically amplify DPY19L2" due to concomitant amplification of pseudogenes .

How can recombinant DPY19L2P2 be expressed for research purposes?

Though DPY19L2P2 is a pseudogene with premature stop codons, researchers might want to express modified versions for comparative studies. The methodological approach would involve:

  • Gene synthesis and modification:

    • Create a synthetic construct with stop codons removed

    • Option to include epitope tags for detection and purification

    • Codon optimization for the selected expression system

  • Expression system selection based on protein characteristics:

    • Mammalian expression systems are preferable for transmembrane proteins

    • Insect cell systems like Sf9 or High Five cells using baculovirus vectors

    • Cell-free systems for initial expression testing

  • Membrane protein purification strategy:

    • Detergent screening for optimal solubilization

    • Affinity chromatography using added tags

    • Size exclusion chromatography for final purification

  • Validation methods:

    • Western blotting with antibodies against the tag or against DPY19L2

    • Mass spectrometry for protein verification

    • Circular dichroism to assess secondary structure

The challenges of expressing multipass transmembrane proteins would parallel those faced when raising antibodies against DPY19L2, which required specialized approaches as mentioned in the research materials .

What approaches can determine if DPY19L2P2 is transcribed despite being a pseudogene?

Pseudogenes may be transcriptionally active even when they don't produce functional proteins. To investigate potential DPY19L2P2 transcription:

  • Tissue-specific RT-PCR:

    • Design primers specific to unique features of DPY19L2P2

    • Include controls to distinguish from genomic DNA contamination

    • Sequence verification of products to confirm pseudogene-specific amplification

  • RNA-Seq analysis with specific computational pipeline:

    • Deep sequencing to capture low-abundance transcripts

    • Specialized alignment allowing for discriminating SNPs and indels

    • Transcript reconstruction algorithms to validate exon structure

  • 5' RACE and 3' RACE:

    • Identify actual transcription start sites and polyadenylation sites

    • Characterize potential alternative promoters or terminators

    • Verify transcript structure compared to the functional gene

  • Single-cell RNA-Seq:

    • Detect potential rare cell populations expressing the pseudogene

    • Assess co-expression patterns with functional DPY19L2

These approaches would build on the expression analysis methods mentioned in the search results, where researchers determined expression patterns through sequencing of RT-PCR products .

What experimental designs can investigate potential regulatory roles of DPY19L2P2?

Though not protein-coding, pseudogenes can serve regulatory functions. To investigate potential roles of DPY19L2P2:

  • Transcriptional interference assays:

    • Reporter gene constructs with DPY19L2P2 locus

    • CRISPR activation/inhibition of the pseudogene locus to assess effects on nearby genes

  • RNA-based regulatory function assessment:

    • RNA pulldown assays to identify interacting partners

    • MicroRNA binding site analysis and validation

    • Antisense regulation potential through complementary regions to DPY19L2

  • Chromatin organization studies:

    • Chromosome conformation capture (3C, 4C, Hi-C) to identify interactions with other genomic regions

    • ATAC-seq to assess chromatin accessibility at the pseudogene locus

    • ChIP-seq for histone modifications to characterize epigenetic state

  • Evolutionary significance analysis:

    • Population genomics to identify selective pressures on pseudogene sequence

    • Cross-species comparison to determine conservation of the pseudogene

These approaches would help determine whether DPY19L2P2 has acquired novel regulatory functions despite losing protein-coding capacity, a phenomenon increasingly recognized in pseudogene evolution .

How do deletions in DPY19L2 lead to globozoospermia, and what might this reveal about potential functions of DPY19L2P2?

The research clearly establishes that homozygous deletion of functional DPY19L2 causes globozoospermia, a form of male infertility characterized by round-headed sperm lacking acrosomes . This understanding provides context for investigating DPY19L2P2:

  • Mechanism of DPY19L2 function in spermatogenesis:

    • DPY19L2 is necessary for proper sperm head elongation and acrosome formation

    • The protein is expressed in testis during spermiogenesis but absent from mature sperm

    • DPY19L2 likely functions in cell polarity based on its C. elegans ortholog function

  • Potential relationship of DPY19L2P2 to this function:

    • As a pseudogene arising from duplication, DPY19L2P2 shares the ancestral sequence that evolved for this specialized function

    • The presence of multiple pseudogenes may relate to genomic instability that leads to pathogenic deletions

    • LCRs containing pseudogenes like DPY19L2P2 may facilitate the NAHR events that cause DPY19L2 deletions in patients

  • Experimental approaches to investigate relationships:

    • Analyze correlation between DPY19L2P2 sequence variations and DPY19L2 deletion frequencies

    • Investigate whether transcribed DPY19L2P2 RNA interacts with DPY19L2 transcripts

    • Assess whether LCR structure containing DPY19L2P2 influences recombination hotspots

Understanding these relationships could provide insight into both the evolutionary forces shaping the DPY19L gene family and potential mechanisms contributing to globozoospermia risk .

What can be learned from comparative genomic studies of DPY19L2P2 across different populations?

Comparative genomic approaches can reveal important insights about DPY19L2P2 evolution and potential impact:

  • Population frequency analysis:

    • Assessment of copy number variation frequency across populations

    • Identification of population-specific variants within the pseudogene

    • Correlation with DPY19L2 deletion frequencies in different populations

  • Haplotype structure analysis:

    • Characterization of linkage disequilibrium patterns around DPY19L2P2

    • Identification of selective events that might have shaped pseudogene evolution

    • Detection of population-specific recombination patterns

  • Comparative analysis with non-primate mammals:

    • Detailed examination of genomic regions syntenic to human DPY19L2P2 in other species

    • Assessment of selective pressures before and after pseudogenization events

    • Investigation of species-specific duplications and losses

This type of analysis would build on observations from the search results indicating that "the duplication of DPY-19 eventually led to the acquisition of a new specialized function in spermiogenesis, in what could be seen as a paradigm for neofunctionalization through gene duplication" .

How might CRISPR-Cas9 genome editing be used to study the functional significance of DPY19L2P2?

CRISPR-Cas9 technology provides powerful tools for investigating DPY19L2P2:

  • Pseudogene knockout experiments:

    • Delete the entire DPY19L2P2 locus to assess potential effects on DPY19L2 expression

    • Remove specific regulatory elements within the pseudogene

    • Assess effects on chromatin organization and nearby gene expression

  • "Rescue" experiments:

    • Edit stop codons to create a theoretically functional version of DPY19L2P2

    • Express this modified gene in cells from globozoospermia patients

    • Assess whether any functional aspects can be restored

  • LCR structure manipulation:

    • Delete or modify LCRs containing DPY19L2P2 to assess effects on genomic stability

    • Engineering various structural configurations to test recombination mechanisms

    • Create minimal synthetic LCRs to determine essential elements for NAHR

  • Humanized mouse models:

    • Introduce human DPY19L2P2 into mouse genome that naturally lacks it

    • Assess potential phenotypic effects or genomic instability

    • Compare with models containing functional DPY19L2 modifications

These approaches would help elucidate whether DPY19L2P2 has acquired functions beyond being a pseudogenized duplicate, potentially informing both evolutionary biology and reproductive medicine .

How can structural biology approaches be applied to understand DPY19L protein family function?

The DPY19L protein family, including the theoretical structure of DPY19L2P2 if it were expressed, can be studied through various structural biology approaches:

  • Prediction of protein structure:

    • Computational modeling based on the 6-11 predicted transmembrane domains

    • Comparative modeling using related proteins from the DPY19L family

    • Analysis of conserved domains across family members

  • Experimental structure determination challenges:

    • Crystallization challenges for multi-pass membrane proteins

    • Cryo-electron microscopy as an alternative approach

    • NMR for specific domains or fragments

  • Structure-function relationship analysis:

    • Mapping functional domains based on evolutionary conservation

    • Identifying critical residues for protein-protein interactions

    • Understanding how mutations in DPY19L2 lead to dysfunction

  • Comparative analysis with C. elegans DPY-19:

    • Leveraging known function in cell polarity from C. elegans studies

    • Identifying conserved functional motifs across species

    • Understanding specialization in the vertebrate lineage

These approaches would build on the limited functional information available, particularly the observation that DPY19L proteins are "multipass membrane proteins likely to contain 6-11 transmembrane domains" and that DPY-19 in C. elegans "was shown to be necessary for the correct polarization of C. elegans" .

What diagnostic applications might emerge from improved understanding of DPY19L2 and its pseudogenes?

Enhanced knowledge of DPY19L2 and pseudogenes like DPY19L2P2 could lead to improved diagnostic approaches:

  • Refined genetic testing for globozoospermia:

    • More accurate detection of DPY19L2 deletions in patients

    • Better discrimination between deletions and point mutations

    • Development of breakpoint-specific assays for common deletion variants

  • Population screening approaches:

    • Identification of at-risk individuals or populations with higher deletion frequency

    • Carrier testing in family members of affected individuals

    • Preconception genetic counseling options

  • Technical improvements in deletion detection:

    • Long-range PCR methods to better characterize deletion breakpoints

    • Custom array designs for improved copy number analysis

    • Targeted sequencing approaches specific to LCR regions

  • Comprehensive DPY19L family screening:

    • Multiplex assays covering all family members and pseudogenes

    • Identification of potential compound effects from multiple gene variations

    • Integration with broader reproductive genetics panels

These advances would address challenges noted in the research where "we have not yet succeeded in sequencing the gene in totality" and would improve upon detection methods like the "PCR amplification of two exons (1 and 11)" used to screen populations .

How does non-allelic homologous recombination (NAHR) in the DPY19L regions contribute to human genomic disorders?

The DPY19L2 region provides an excellent model for studying NAHR mechanisms and consequences:

  • Mechanism of NAHR in DPY19L region:

    • Recombination between highly homologous (97% identity) 28 kb LCR sequences

    • These events create approximately 200 kb deletions encompassing DPY19L2

    • Multiple potential recombination configurations: interchromosomal, interchromadid, and intrachromatid NAHR

  • Population genetics of NAHR events:

    • Unexpectedly higher frequency of duplications (1.8%) than deletions (0.8%) at the DPY19L2 locus

    • Potential negative selection against deleted alleles due to male infertility

    • Possibility of positive selection for duplicated alleles

  • Relationship to other genomic disorders:

    • Comparison with other LCR-mediated deletion syndromes

    • Analysis of whether similar mechanisms operate in other regions

    • Investigation of factors affecting NAHR frequency in different genomic contexts

This research would expand on observations that "DPY19L2 CNV is caused by nonallelic homologous recombination (NAHR) between LCRs 1 and 2" and that different NAHR mechanisms "are expected to produce a higher proportion of deletions than duplications" .

What novel therapeutic approaches might emerge from research on DPY19L2 and its pseudogenes?

Understanding DPY19L2 function and its relationship to pseudogenes like DPY19L2P2 could lead to innovative therapeutic strategies:

  • Targeted therapies for globozoospermia:

    • Gene therapy approaches to restore DPY19L2 function

    • Protein replacement strategies for specific cell types

    • Small molecule modulators of remaining DPY19L family members to compensate for loss

  • Contraceptive development:

    • The search results mention a patent filing describing "the use of DPY19L2 inhibitors to achieve male contraception"

    • Targeted approaches to temporarily disrupt DPY19L2 function

    • Reversible contraceptive methods based on protein function modulation

  • Assisted reproductive technology improvements:

    • Better prediction of ICSI success rates in globozoospermia patients

    • Development of sperm selection methods for patients with partial defects

    • Specialized protocols for cases with DPY19L2 mutations

  • Genomic instability prevention:

    • Approaches to reduce NAHR frequency in susceptible regions

    • Methods to detect individuals at higher risk for deletion events

    • Strategies to stabilize repetitive genomic regions

These therapeutic directions would address the current situation where globozoospermia diagnosis "assigns a poor prognosis for the success of in vitro fertilization" and could potentially move beyond diagnosis to treatment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.