Recombinant Human Putative protein FAM172B (FAM172BP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FAM172BP; FAM172B; Putative protein FAM172B; FAM172B pseudogene
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-362
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
FAM172BP
Target Protein Sequence
MTQELSFQKFIEQSDLLGELKYDFNEKDEFRHTETQRPFVFNYYENVLEKNSKRYQALGH LLEQYIYELLEKVCKLEKVYIPPEADKEEPRSFFFMSEKALTNHHSALLILLQDHGVFRA GQWSQQAIIHHGLQHGSQIPCIQMALQAHYDVIVLNPNDNFVEPKVEKEWKGLLTQNIES SSLKMVQGGSFFSLQHPPKCIPKRCSNTPEEHTAYIWDYFISKTEGKDIAFIVHGYGGLV FMDLLVRRRWEVMSKVYAVALIDSEHHVGHQLGSDVQLLAWIKHHCREWVTSPKPLDKPA ATVFKKEFPMVSAGTEKYILAPSSSLQSIFKYFKKALKARTTINFSRMPIVTRSSTKRKQ SA
Uniprot No.

Target Background

Database Links

HGNC: 34336

UniGene: Hs.518125

Protein Families
UPF0528 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

How does FAM172BP differ from other members of the FAM172 family?

While FAM172BP is relatively understudied, more research has been conducted on FAM172A, which provides context for understanding the potential functions of FAM172BP:

  • FAM172A has been identified at the translational level and contains an Arb2 conserved domain

  • FAM172A expression is upregulated by high glucose levels in human aortic smooth muscle cells

  • FAM172A promotes cell proliferation via the p38 MAPK pathway and may be involved in papillary thyroid carcinoma pathogenesis

In contrast to FAM172A, FAM172BP is classified as a pseudogene, suggesting it may not encode a functional protein despite sequence similarity to other family members. Further comparative studies are needed to elucidate structural and functional differences within this protein family.

What are the optimal expression systems for producing recombinant FAM172BP?

Based on established protocols for related proteins, researchers should consider:

  • Expression System Selection: While no specific data exists for optimal FAM172BP expression, related proteins in the FAM family have been successfully expressed in:

    • HEK293 cells (as demonstrated for FAM171B )

    • E. coli (as used for TAFA2/FAM19A2 )

  • Vector Design Considerations:

    • Include appropriate tags (His-tag is commonly used )

    • Optimize codon usage for the selected expression system

    • Consider using eukaryotic expression vectors like PDC315 and pEGFP-N2, which have been successful for FAM172A

  • Purification Strategy:

    • Design a purification protocol including affinity chromatography

    • Include quality control steps to verify purity (>90%) and endotoxin levels (<1 EU/μg)

    • Validate protein identity through mass spectrometry and SDS-PAGE analysis

How should I design experiments to investigate potential functions of FAM172BP?

Given the limited knowledge about FAM172BP, a systematic approach is recommended:

  • Comparative Analyses with FAM172A:

    • Examine subcellular localization patterns (FAM172A localizes primarily to the nucleus )

    • Test responsiveness to high glucose concentrations in similar cell types (aortic endothelial, aortic smooth muscle cells, and macrophages )

    • Investigate potential involvement in the p38 MAPK pathway through Western blotting

  • Expression Profile Analysis:

    • Determine tissue expression patterns using RT-PCR and Western blotting

    • Compare expression levels across different cell types and disease models

    • Consider using a human gene expression predictor approach as described in source

  • Function Prediction Experiments:

    • Design knockdown/overexpression experiments

    • Assess effects on cell proliferation (MTT assays )

    • Monitor pathway activation using phospho-specific antibodies for p38 MAPK, PI3K, and AMPK pathways

What are the best approaches for studying potential roles of FAM172BP in disease pathways?

When investigating FAM172BP in disease contexts:

  • Neurodegenerative Disease Models:

    • Given the role of FAM171A2 in regulating progranulin (a protein associated with neurodegenerative diseases) , consider examining FAM172BP in similar contexts

    • Measure cerebrospinal fluid (CSF) levels in neurodegenerative disease models

    • Investigate genetic associations with disease risk through SNP analysis

  • Vascular Pathology Models:

    • Since FAM172A is implicated in high glucose-induced vascular damage , examine FAM172BP expression in:

      • Diabetic models

      • Vascular inflammation models

      • Atherosclerosis models

  • Cancer Models:

    • Based on FAM172A's role in promoting cell proliferation in thyroid cancer , design experiments to test if FAM172BP affects:

      • Cell proliferation rates

      • Migration and invasion capabilities

      • Apoptosis resistance

How should I analyze and interpret contradictory data when studying FAM172BP?

When faced with inconsistent results:

  • Context-Dependent Analysis:

    • Consider that protein function may vary based on cellular context, as seen with p38 MAPK, which can promote both cell proliferation and apoptosis depending on cell type and conditions

    • Document all experimental variables thoroughly, including cell type, culture conditions, and reagent concentrations

  • Multi-Method Validation:

    • Use complementary experimental approaches to validate findings

    • As highlighted in source : "Different biological measures often require different inferences... the meaning of the concept must specify the source of evidence that was used to make the inference"

  • Statistical Approach:

    • Apply appropriate statistical methods based on experimental design

    • Consider using analysis of variance (ANOVA) to analyze multiple experimental conditions

    • Use confidence intervals to estimate population characteristics

    • Implement statistical computing packages for biomedical data analysis

What techniques can detect interactions between FAM172BP and other proteins or signaling pathways?

To identify potential interaction partners and signaling connections:

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation (Co-IP)

    • Yeast two-hybrid screening

    • Proximity ligation assays (PLA)

    • Mass spectrometry-based interactome analysis

  • Pathway Perturbation Analysis:

    • Use selective inhibitors (like SB202190 for p38 MAPK ) to assess pathway involvement

    • Apply phosphoproteomic approaches to identify downstream effectors

    • Consider gene expression predictor models to infer transcriptional regulators

  • Data Integration Framework:

    • Integrate findings from multiple experimental approaches

    • Apply network analysis to position FAM172BP within known signaling networks

    • Use bioinformatics tools to predict functional domains and potential interaction sites

How can insights from FAM172A research be applied to study FAM172BP?

FAM172A research provides several methodological approaches applicable to FAM172BP:

  • Expression Analysis Methodology:

    • Employ Western blotting techniques validated for FAM172A detection

    • Apply confocal laser scanning microscopy to determine subcellular localization

    • Use bioinformatics to identify conserved domains (FAM172A contains an Arb2 domain)

  • Functional Assays:

    • Test effects on cell proliferation using MTT assays and growth curve analysis

    • Investigate concentration-dependent and time-course responses to stimuli

    • Examine response to stress conditions like high glucose exposure

  • Signaling Pathway Investigation:

    • Focus on p38 MAPK pathway analysis, as FAM172A activates this pathway

    • Test effects of FAM172BP overexpression on multiple signaling pathways (p38 MAPK, PI3K, AMPK)

    • Use pathway inhibitors to confirm functional relationships

What can genetic studies of FAM family members tell us about potential FAM172BP functions?

Genetic approaches that could yield insights include:

  • Genome-Wide Association Studies (GWAS):

    • FAM171A2 variants were associated with cerebrospinal fluid progranulin levels and neurodegenerative disease risk

    • Consider investigating FAM172BP genetic variants in similar contexts

    • Design studies that account for sex, educational level, and APOE ε4 status as potential confounders

  • Expression Quantitative Trait Loci (eQTL) Analysis:

    • Investigate whether genetic variants influence FAM172BP expression levels

    • Examine tissue-specific expression patterns using public databases

    • Consider linkage disequilibrium analysis when interpreting genetic associations

  • Comparative Genomics:

    • Analyze conservation patterns across species (human, chicken, cow FAM172BP)

    • Compare genomic organization of FAM172 family members

    • Investigate evolutionary relationships within the FAM172 family

What are common challenges in working with recombinant FAM172BP and how can they be addressed?

Researchers may encounter several technical challenges:

  • Expression and Purification Issues:

    • Challenge: Low expression levels or insoluble protein

    • Solution: Optimize expression conditions (temperature, induction time), consider fusion tags that enhance solubility, or try alternative expression systems

  • Protein Stability Concerns:

    • Challenge: Protein degradation during purification or storage

    • Solution: Include protease inhibitors, optimize buffer conditions, determine appropriate storage conditions (temperature, glycerol percentage)

  • Functional Activity Assessment:

    • Challenge: Uncertain functional assays for a putative protein

    • Solution: Design experiments based on known functions of related proteins, perform multiple assay types, include positive controls

How can I validate antibodies for FAM172BP detection given its status as a putative protein?

Antibody validation is particularly challenging for putative proteins:

  • Multiple Antibody Approach:

    • Use antibodies targeting different epitopes

    • Compare commercial antibodies from different vendors

    • Consider developing custom antibodies against specific regions

  • Validation Controls:

    • Use recombinant FAM172BP as a positive control

    • Include knockout/knockdown samples as negative controls

    • Test cross-reactivity with other FAM family members

  • Complementary Detection Methods:

    • Combine antibody-based detection with mass spectrometry

    • Use tagged recombinant constructs that can be detected via the tag

    • Consider RNA-level detection (RT-PCR, RNA-seq) to complement protein detection

What experimental design considerations are critical when studying pseudogenes like FAM172BP?

When investigating pseudogenes, consider:

  • Transcriptional Analysis:

    • Determine if the pseudogene is transcribed

    • Design PCR primers that distinguish between the pseudogene and related functional genes

    • Use RNA-seq to quantify expression levels across tissues

  • Functional Study Design:

    • Consider potential regulatory roles of pseudogene transcripts

    • Investigate whether the pseudogene might influence the expression of related functional genes

    • Design loss-of-function experiments using siRNA or CRISPR targeting

  • Evolutionary Context:

    • Compare the pseudogene sequence with functional homologs

    • Identify when the pseudogenization event occurred in evolutionary history

    • Consider species-specific differences in pseudogene status

How should researchers interpret FAM172BP expression data in different cellular contexts?

For proper interpretation of expression data:

  • Context-Specific Analysis:

    • Consider that expression may vary significantly across tissues (as seen with related proteins like TAFA2/FAM19A2, which shows 50-1000× higher expression in CNS than other tissues)

    • Account for experimental conditions that might affect expression (stress, disease state, cell confluence)

    • Compare with expression patterns of other FAM family members

  • Quantification Methods:

    • Use appropriate normalization controls

    • Consider both RNA and protein-level quantification

    • Apply statistical methods suitable for expression data analysis

  • Functional Correlation:

    • Correlate expression levels with cellular phenotypes

    • Consider temporal dynamics of expression

    • Integrate with pathway activity data

What are the best practices for designing control experiments when studying FAM172BP?

Robust control design should include:

  • Negative Controls:

    • Empty vector controls for overexpression studies

    • Non-targeting siRNA/shRNA for knockdown experiments

    • Isotype controls for antibody-based detection

  • Positive Controls:

    • Include well-characterized related proteins (FAM172A)

    • Use known pathway activators/inhibitors as reference points

    • Include samples with validated expression/activity

  • Experimental Validation Controls:

    • Technical replicates to assess method reproducibility

    • Biological replicates to account for sample variation

    • Independent methods to validate key findings

As recommended in experimental design literature, "consider your variables and how they are related" and "write a specific, testable hypothesis" before designing your experimental treatments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.