Recombinant Human Putative protein FAM74A3 (FAM74A3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
FAM74A3; Putative protein FAM74A3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-159
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
FAM74A3
Target Protein Sequence
MWRELRGCPGGDVETAQRLSRRRRGKSSEAVPEKTWRAQRMSQTRESSEAVPEKTWREFR GCPGEDVERAQKLRDCPGEDMETAQTLSARRRAESSEAVPEKTWRELKGCPQEDVERVQR LSLLLHLAVFLWIIIAINFSNSGVKSQSSTYLPSGKILK
Uniprot No.

Target Background

Database Links

HGNC: 32031

UniGene: Hs.723007

Protein Families
FAM74 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What expression systems are most suitable for producing Recombinant Human FAM74A3?

Bacterial expression systems, particularly E. coli, offer a straightforward approach for initial production of Recombinant Human FAM74A3. Based on established protocols with other recombinant human proteins, expression can be optimized using vectors such as pET series (e.g., pET40b+) with appropriate restriction sites . The expression construct should contain the FAM74A3 cDNA sequence without signal sequence, and may benefit from a C-terminal his-tag to facilitate later purification. Optimal expression conditions typically involve inducing with IPTG at bacterial culture optical density of approximately 0.3, followed by cultivation for 4-5 hours at 37°C . Each liter of E. coli culture can potentially yield milligram quantities of recombinant protein, though yields may vary based on specific protein characteristics.

How can inclusion bodies containing FAM74A3 be effectively isolated and solubilized?

When expressed in bacterial systems, Recombinant Human FAM74A3 likely forms inclusion bodies, similar to other human recombinant proteins. For isolation, resuspend bacterial cell pellets in lysis buffer containing protease inhibitors (typically 50 mM Tris, pH 8, 2 mM EDTA, 0.5% Triton X-100), then mechanically disrupt cells using either French Press or sonication . Inclusion bodies can be separated from cell supernatant by centrifugation at approximately 18,000×g at 2-8°C for 20 minutes. The resulting inclusion body pellet should be solubilized in resuspension buffer containing a strong denaturant such as 6M guanidine hydrochloride, along with a reducing agent like 10 mM DTT . Complete solubilization can be achieved by repeatedly passing the mixture through an 18-gauge needle until the solution becomes clear.

What refolding strategies are most effective for FAM74A3 recovery from inclusion bodies?

Refolding strategies for FAM74A3 from inclusion bodies should follow established protocols for recombinant proteins that form inclusion bodies in E. coli. The solubilized protein can be slowly diluted into refolding buffer to reduce denaturant concentration gradually, allowing proper reformation of disulfide bonds and secondary structure . The refolding buffer composition will need optimization, but typically contains redox pairs (reduced/oxidized glutathione) to facilitate proper disulfide bond formation. The dilution approach minimizes protein aggregation during the refolding process and has been successfully applied to various cytokines and bioactive proteins . The refolded protein solution can then be concentrated and purified using chromatographic methods, particularly taking advantage of the histidine tag if incorporated into the construct design.

How can experimental designs be optimized to evaluate FAM74A3 functional activity?

Evaluating the functional activity of Recombinant Human FAM74A3 requires careful experimental design considerations. When designing such experiments, researchers should employ true experimental designs with appropriate controls, rather than pre-experimental designs that lack controls or randomization . For instance, the Pretest-Posttest Control Group Design (with random assignment, experimental intervention, and control group) provides strong internal validity by controlling for confounding variables such as history, maturation, and testing effects .

To properly evaluate FAM74A3 activity, several specific threats to validity must be addressed:

  • History effects - controlling for specific events occurring between measurements

  • Maturation processes - accounting for changes within experimental systems over time

  • Testing effects - minimizing the impact of preliminary measurements on subsequent observations

  • Instrumentation challenges - ensuring consistent calibration of measuring instruments

What theoretical frameworks best guide mixed-methods approaches to FAM74A3 characterization?

Comprehensive characterization of FAM74A3 benefits from mixed-methods approaches that combine quantitative biochemical/biophysical analysis with qualitative structural characterization. Adopting a pragmatic theoretical framework can guide such integration, where the focus remains on the research problem rather than methodological purism . This approach allows researchers to move flexibly between deductive and inductive reasoning, particularly valuable when characterizing novel proteins like FAM74A3 .

A well-structured theoretical framework for FAM74A3 characterization should:

  • Connect epistemological considerations with concrete research design decisions

  • Facilitate integration between qualitative and quantitative methods at multiple investigation phases

  • Provide a conceptual map for combining different analytical techniques

  • Enable abductive reasoning that allows movement between theory and experimental data

This integrated approach allows researchers to triangulate findings from different methodologies (e.g., mass spectrometry, crystallography, functional assays) to develop a comprehensive understanding of FAM74A3's structure-function relationships .

What strategies can address contradictory findings in FAM74A3 functional studies?

When confronting contradictory data in FAM74A3 functional studies, researchers should carefully evaluate potential regression artifacts and selection-maturation interactions that may be misinterpreted as true effects . Statistical regression toward the mean can create the appearance of changes that are actually artifacts of measurement, particularly when examining extreme values .

To address contradictions systematically:

  • Use time-reversed control analyses to distinguish true effects from regression artifacts

  • Directly examine changes in population variabilities between measurements

  • Consider potential selection-maturation interactions that may be confounded with experimental variables

Additionally, adopting a mixed-methods framework allows integration of seemingly contradictory findings by considering them from multiple perspectives, potentially revealing complementary rather than contradictory aspects of FAM74A3 function . This approach creates dialogue between different ways of interpreting data and shifts focus from methodological disagreement to deeper understanding of the protein's biological roles.

What chromatography strategies yield highest purity FAM74A3 after refolding?

Purification of refolded FAM74A3 can be accomplished through a combination of chromatographic techniques. Immobilized metal affinity chromatography (IMAC) serves as an excellent initial purification step if the recombinant protein contains a histidine tag . For further purification, size exclusion chromatography effectively separates properly folded monomeric protein from aggregates and improperly folded species. Ion exchange chromatography may also be employed as an intermediate or polishing step, with the specific type (cation or anion exchange) dependent on FAM74A3's isoelectric point.

The purification protocol should be optimized to maximize both yield and biological activity, as improperly folded species may co-purify but lack functionality. Each purification step should be validated through SDS-PAGE analysis and, where appropriate, Western blotting to confirm identity . The final purified protein should undergo bioactivity testing to confirm proper folding and functionality before use in advanced research applications.

How can researchers distinguish between properly folded and misfolded forms of FAM74A3?

Distinguishing properly folded FAM74A3 from misfolded species requires multiple analytical techniques. Circular dichroism (CD) spectroscopy provides valuable information about secondary structure content, while fluorescence spectroscopy can reveal tertiary structure characteristics through analysis of tryptophan and tyrosine environments. Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) can determine whether the protein exists in the expected oligomeric state and identify any aggregation.

Thermal shift assays (differential scanning fluorimetry) offer insight into protein stability and can help identify buffer conditions that stabilize the properly folded conformation. Limited proteolysis followed by mass spectrometry analysis can reveal whether the protein has adopted a compact, folded structure resistant to proteolytic cleavage. Ultimately, functional assays specific to FAM74A3's biological role provide the most relevant confirmation of proper folding, as they directly connect structure to function.

What are the most effective experimental designs for studying FAM74A3 interactions with binding partners?

Studying FAM74A3 interactions with potential binding partners requires robust experimental designs that control for various threats to validity. True experimental designs with appropriate controls should be employed rather than pre-experimental approaches . When investigating protein-protein interactions, researchers should consider both the internal validity (controlling for history, maturation, testing effects) and external validity (generalizability) of their experimental approach .

Effective experimental designs might include:

  • Solomon Four-Group Design - controls for testing effects when measuring binding interactions

  • Posttest-Only Control Group Design - minimizes interference when measurement itself might influence binding

  • Time-series designs - particularly valuable for studying binding kinetics over various timepoints

For binding studies, careful consideration should be given to potential instrumentation effects, as changes in calibration or sensitivity of equipment (such as surface plasmon resonance instruments) may be mistaken for genuine interaction differences .

How can theoretical frameworks guide integration of structural and functional data for FAM74A3?

Integration of structural and functional data for comprehensive FAM74A3 characterization benefits from appropriate theoretical frameworks that facilitate mixed-methods approaches. A pragmatic framework allows researchers to move between inductive approaches (building theory from observed structural features) and deductive approaches (testing hypotheses about structure-function relationships) .

This integrated approach enables:

  • Abductive reasoning - moving between theory and data to develop explanatory models

  • Intersubjectivity - reconciling objective structural data with more subjective functional interpretations

  • Transferability - applying insights from FAM74A3 to understand related proteins

By establishing a theoretical framework before beginning investigations, researchers can better connect epistemological considerations with specific research design decisions, creating a roadmap for how different types of data will be integrated to build a comprehensive understanding of FAM74A3 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.