Recombinant Human Putative protein unc-93 homolog B1-like protein

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Target Protein Sequence
MCKLSAQQSVEFLFLGYGVCSVGLEWLAYLLVAYSLGASAASLLVLLGLWLPHPVPLVAG EGVHLLLTFILFFWAPVPQVLQHSWILCVAAALWGVGSALNKTGLSTLLGILYEDKERQD FIFTIYHWWQAVAIFTVYLGSSLHMKAKLAVLLVTLVVAAVSYLRMEQKLRRGVAPRQPR IPRPQHKVRGDGYLEEDNSDESDAEGEHGDGAEEEAPPPGPRPGPEPAGLGRRPCPYEQA QGGDGPEEQ
Uniprot No.

Q&A

What is UNC-93B1 and what is its primary function?

UNC-93B1 is an endoplasmic reticulum (ER) resident protein characterized by a 12-helical membrane spanning structure. It serves as a critical accessory protein that physically interacts with and regulates nucleic acid-sensing Toll-like receptors (NAS TLRs), particularly TLR3, TLR7, and TLR9. Its primary function involves sorting these TLRs to endosomes, which is essential for their ability to respond to microbial nucleic acids while preventing autoimmune responses. This protein was initially identified through a forward genetic screen using N-ethyl-N-nitrosourea, where a histidine-to-arginine substitution caused significant defects in TLR signaling pathways . The human UNC-93B1 represents a homolog of the Caenorhabditis elegans Unc93 gene, though with evolved specialized functions in the mammalian immune system.

How does UNC-93B1 relate to innate immunity?

UNC-93B1 plays a fundamental role in innate immunity through its regulation of nucleic acid-sensing TLRs. These receptors are crucial for detecting pathogen-associated molecular patterns (PAMPs) derived from microbial DNA and RNA. Studies have demonstrated that mice carrying the H412R point mutation (known as the 3d mutation) in UNC-93B1 are highly susceptible to infection with numerous viruses and intracellular pathogens, including cytomegalovirus, Listeria monocytogenes, and Staphylococcus aureus . This susceptibility stems from the complete deficiency in NAS TLR signaling caused by the mutation. Furthermore, human patients with UNC-93B1 deficiency exhibit impaired interferon-α/β and -λ antiviral responses, highlighting the protein's critical role in host defense mechanisms . The functional relationship between UNC-93B1 and TLRs represents a key component of the first-line defense system against invading pathogens.

What distinguishes UNC-93B1 from other UNC-93 homologs?

UNC-93B1 differs significantly from other UNC-93 homologs, particularly UNC-93A, in its functional specificity and evolutionary adaptation. While both proteins share homology with the C. elegans Unc93 gene, UNC-93B1 has evolved distinct functional properties. Unlike UNC-93A, whose function remains largely unknown, UNC-93B1 specifically interacts with TLR3, TLR7, and TLR9 . This interaction is critical for the proper functioning of these receptors in immune signaling pathways. The histidine-to-arginine point mutation that identified UNC-93B1 abolishes this interaction, demonstrating its specificity. Additionally, while the C. elegans unc-93 gene is primarily involved in muscle contraction regulation, the mammalian UNC-93B1 has specialized to function predominantly in immune regulation . This evolutionary divergence in function represents an interesting example of how conserved gene families can adopt new roles across different species.

How does UNC-93B1 regulate TLR trafficking and signaling at the molecular level?

UNC-93B1 regulates TLR trafficking through direct physical interactions with the transmembrane domains of nucleic acid-sensing TLRs. This interaction is crucial for proper translocation of these receptors to endosomes, where they can effectively detect microbial nucleic acids. Research has revealed that UNC-93B1 not only facilitates trafficking but also significantly impacts receptor stability and signaling capacity. Specifically, UNC-93B1 increases the protein lifetime of TLR3 and TLR9, with overexpression of UNC-93B1 decreasing the degradation rate of TLR3 upon inhibition of protein synthesis (extending half-life from 3.8 hours to 12 hours) . Furthermore, UNC-93B1 exhibits a unique relationship with TLR3, as its expression promotes trafficking of differentially glycosylated TLR3, but not other NAS TLRs, to the plasma membrane . This selective surface localization of TLR3 may enable it to capture circulating dsRNA resulting from viral infections, representing a specialized adaptation in antiviral immunity.

What are the implications of UNC-93B1 mutations for human disease susceptibility?

Mutations in UNC-93B1 have profound implications for human disease susceptibility, particularly regarding infectious and autoimmune conditions. The most well-characterized mutation is the H412R (3d) mutation, which results in complete deficiency in NAS TLR signaling . Human patients with UNC-93B1 deficiency show severely impaired interferon responses and increased susceptibility to viral infections. Beyond infectious disease, UNC-93B1 mutations can also impact autoimmune regulation. The D34A mutation, which modifies the selectivity of UNC-93B1 for TLR7 versus TLR9, has been shown to result in a lethal autoimmune response in mice . This highlights the delicate balance UNC-93B1 maintains in regulating immune responses to foreign versus self nucleic acids. The identification of these mutations provides valuable insights for understanding immunodeficiency disorders and potentially explaining idiopathic autoimmune conditions in certain patient populations.

What feedback mechanisms regulate UNC-93B1 expression and function?

UNC-93B1 regulation involves a sophisticated feedback loop that connects TLR3 activation with UNC-93B1 expression. Studies have demonstrated that poly(I:C), a synthetic analog of dsRNA that activates TLR3, significantly up-regulates UNC-93B1 transcription and expression . This up-regulation is triggered specifically through TLR3 activation, as other TLR agonists do not produce the same effect. Analysis of the UNC-93B1 promoter region has revealed binding sites for key transcription factors including IRF-3, NF-κB, AP-1, and cJun-ATF2, all of which can be activated by TRIF-mediated signaling downstream of TLR3 . Additionally, treatment with IFN-β also increases UNC-93B1 expression, suggesting involvement of type I interferon signaling in its regulation. This creates a positive feedback mechanism where TLR3 activation leads to increased UNC-93B1 expression, which in turn enhances TLR3 function and stability, ultimately priming cells for an augmented response against infection.

What techniques are most effective for studying UNC-93B1 interactions with TLRs?

Several complementary techniques have proven effective for investigating UNC-93B1 interactions with TLRs. Co-immunoprecipitation assays represent a primary approach to confirm physical interactions between UNC-93B1 and TLRs, as these proteins naturally associate in cellular compartments. For detailed interaction mapping, techniques such as yeast two-hybrid systems or GST pull-down assays using purified protein domains can help identify specific interaction motifs. When studying trafficking dynamics, confocal microscopy with fluorescently tagged proteins has been successfully employed to visualize UNC-93B1-mediated translocation of TLRs to endosomes and the plasma membrane . For functional consequences of these interactions, reporter cell lines expressing NF-κB or IRF3 responsive elements driving luciferase expression provide quantifiable readouts of downstream signaling. Additionally, surface plasmon resonance or microscale thermophoresis with purified protein components can determine binding kinetics and affinities. Researchers should utilize mutational analyses in parallel with these techniques to verify interaction specificity.

How can researchers effectively measure UNC-93B1-dependent TLR trafficking?

Measuring UNC-93B1-dependent TLR trafficking requires methodologies that can track receptor localization with subcellular precision. Flow cytometry represents an effective approach for quantifying surface expression of TLRs, particularly TLR3, which has been shown to translocate to the plasma membrane in an UNC-93B1-dependent manner . For more detailed analysis, confocal microscopy with fluorescently tagged TLRs and compartment-specific markers (e.g., EEA1 for early endosomes, LAMP1 for late endosomes/lysosomes, and calnexin for ER) allows visualization of receptor trafficking patterns. Biochemical fractionation techniques that separate cellular compartments followed by Western blotting can provide complementary quantitative data on TLR distribution. To specifically attribute trafficking effects to UNC-93B1, researchers should implement gain-of-function approaches (UNC-93B1 overexpression) and loss-of-function approaches (siRNA knockdown or CRISPR-Cas9 knockout) in parallel. Additionally, pulse-chase experiments using metabolic labeling can reveal the influence of UNC-93B1 on TLR protein lifetime and degradation rates, which has been demonstrated for TLR3 and TLR9 .

How should researchers interpret contradictory findings related to UNC-93B1 function?

When interpreting contradictory findings related to UNC-93B1 function, researchers should systematically evaluate several key factors that might explain discrepancies. First, consider the cellular context, as UNC-93B1 function may vary significantly between different cell types due to variable expression levels of TLRs and downstream signaling components. For instance, findings in epithelial cells versus immune cells might differ substantially. Second, evaluate the experimental systems employed, noting that overexpression systems may yield different results compared to endogenous protein studies due to potential artifacts from non-physiological protein levels. Third, consider experimental timing, as UNC-93B1 function appears to be dynamically regulated in response to stimuli like poly(I:C) and IFN-β . Fourth, thoroughly examine the specific UNC-93B1 constructs used, as truncations or tags may affect functionality. When contradictions persist despite accounting for these variables, consider that UNC-93B1 may have context-dependent functions or that observed differences might reflect previously uncharacterized regulatory mechanisms. Meta-analysis approaches and collaborative replication studies can help resolve persistent contradictions.

What experimental controls are essential when studying UNC-93B1 in TLR signaling pathways?

When designing experiments to investigate UNC-93B1 in TLR signaling pathways, several controls are essential to ensure data validity and interpretability. First, include the UNC-93B1 H412R (3d) mutant as a negative control, as this mutation abolishes interaction with TLRs and serves as a critical functional control . Second, incorporate TLR4 controls in trafficking and signaling experiments, as TLR4 does not interact with UNC-93B1 and thus provides a specificity control . Third, when studying UNC-93B1-dependent regulation of specific TLRs, include stimulation with agonists for multiple TLR family members to demonstrate specificity (e.g., poly(I:C) for TLR3, CpG DNA for TLR9). Fourth, for transcriptional studies of UNC-93B1 regulation, include bafilomycin A controls to block endosomal acidification and thus inhibit TLR3 signaling, helping to confirm TLR3 dependency . Fifth, when examining UNC-93B1 effects on protein stability, include cycloheximide chase experiments with appropriate time-course controls. Finally, for all overexpression studies, include both empty vector controls and dose-response experiments to account for potential non-specific effects of protein overexpression.

What statistical approaches are most appropriate for analyzing UNC-93B1 effects on TLR responses?

When analyzing UNC-93B1 effects on TLR responses, appropriate statistical approaches should be selected based on the specific experimental design and data characteristics. For comparing UNC-93B1-dependent changes in TLR signaling across multiple experimental conditions, two-way ANOVA with appropriate post-hoc tests (such as Tukey's or Bonferroni) is often suitable, as it can account for both the UNC-93B1 variable and the TLR stimulation variable. For time-course experiments examining UNC-93B1 regulation or its effects on TLR trafficking, repeated measures ANOVA or mixed-effects models may be more appropriate. When analyzing protein half-life data derived from cycloheximide chase experiments, non-linear regression with exponential decay models should be employed to accurately calculate and compare degradation rates . For dose-response relationships between UNC-93B1 expression levels and TLR activation, sigmoidal dose-response curve fitting can provide EC50 values for quantitative comparison. Given the complexity of signaling networks, multivariate analyses such as principal component analysis or partial least squares regression might help identify patterns in large datasets. Regardless of the specific test chosen, researchers should ensure that assumptions of each statistical test are met and report effect sizes alongside p-values to provide a complete picture of biological significance.

How might recombinant UNC-93B1 be used as a research tool?

Recombinant UNC-93B1 offers diverse applications as a research tool across immunology and cell biology. Purified UNC-93B1 protein can serve as a critical reagent for in vitro binding assays to characterize direct interactions with TLR domains and potentially identify novel binding partners. Additionally, structure-function studies using recombinant UNC-93B1 variants could help map critical functional domains and interaction surfaces. For cellular applications, fluorescently tagged UNC-93B1 constructs enable real-time imaging of TLR trafficking and compartmentalization dynamics. In more advanced applications, recombinant UNC-93B1 could be incorporated into artificial membrane systems or liposomes to reconstitute and study TLR trafficking processes in minimal systems. From a diagnostic perspective, recombinant UNC-93B1 could serve as a standard for developing quantitative assays to measure endogenous UNC-93B1 levels in patient samples, potentially correlating expression with disease states. Furthermore, the protein could be utilized to generate high-quality antibodies for immunoprecipitation, Western blotting, and immunohistochemistry applications, expanding the toolkit available for UNC-93B1 research.

What are the implications of UNC-93B1 research for therapeutic development?

Research on UNC-93B1 has significant implications for therapeutic development across several disease areas. Given its central role in nucleic acid-sensing TLR regulation, UNC-93B1-targeted approaches could potentially modulate immune responses in both infectious and autoimmune contexts. For infectious diseases, compounds that enhance UNC-93B1 expression or function might boost antiviral immunity by increasing TLR3, TLR7, and TLR9 responsiveness . Conversely, for autoimmune conditions where inappropriate TLR activation contributes to pathology, inhibitors of UNC-93B1-TLR interactions could dampen inflammatory responses to self-nucleic acids. The discovery that UNC-93B1 selectively regulates surface expression of TLR3 suggests potential for targeted modulation of specific TLR pathways . Additionally, understanding how the D34A mutation modifies UNC-93B1 selectivity for TLR7 versus TLR9 could inspire rational design of modulators with pathway-specific effects . From a vaccine adjuvant perspective, transient UNC-93B1 enhancement could potentially boost immune responses to nucleic acid-based vaccines. As research advances, high-resolution structural information about UNC-93B1-TLR interfaces will likely facilitate structure-based drug design approaches targeting this important regulatory protein.

What open questions remain about UNC-93B1 function and regulation?

Despite significant advances in understanding UNC-93B1, numerous important questions remain unresolved. First, the complete three-dimensional structure of UNC-93B1, particularly in complex with TLRs, has not been determined, limiting our molecular understanding of these interactions. Second, while UNC-93B1's role in regulating TLR3, TLR7, and TLR9 is established, its potential interactions with other innate immune receptors remain largely unexplored. Third, the precise mechanisms by which UNC-93B1 distinguishes between different TLRs and preferentially regulates their trafficking remain unclear. Fourth, the evolutionary history of UNC-93B1 specialization from its C. elegans ancestor warrants further investigation, as it transitioned from a role in muscle contraction regulation to immune function . Fifth, the full spectrum of UNC-93B1 regulation beyond TLR3 and IFN-β signaling, including potential post-translational modifications affecting its function, requires additional research. Sixth, the clinical relevance of UNC-93B1 polymorphisms and expression levels in human populations with variable susceptibility to infectious or autoimmune diseases represents an important epidemiological question. Finally, the complete interactome of UNC-93B1 beyond TLRs may reveal unexpected cellular functions beyond currently established roles in immunity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.